Recombinant Cyan Fluorescent Protein, His-tagged
| Cat.No. : | CFP-2906 |
| Product Overview : | The recombinant CFP (Cyan Fluorescent Protein) is expressed in E. coli with an N-terminal His tag and purified by a method that ensures high purity and maximal CFP fluorescence. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cyan |
| Source : | E.coli |
| Tag : | His |
| Form : | Freeze dried |
| Molecular Mass : | 31.3kDa |
| AA Sequence : | MSGGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLAWGIQCFARY PEHMKMNDFFKSAMPEGYIQERTIHFQDDGKYKTRGEVKFEGDTLVNRVELKGEGFKEDGNILGHKLEYSAISD NVYIMPDKANNGLEANFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSCQSAISKDRNEARDHMVLLE SFSAYCHTHGMDELYRSGLRSRAQASNSAVDGTAGPGSTGSR |
| Endotoxin : | <0.1>0.1> |
| Purity : | ≥97% by SDS-PAGE and HPLC |
| Applications : | Use as standards for SDS-PAGE, Western blot analysis of CFPtransfected cells, label other proteins, calibration of fluorometers and flow cytometers,fluorescence microscope, or microinjection of CFP into cells and tissues, etc. |
| Storage : | -80 centigrade for long-term storage. |
| Reconstitution : | Reconstitute with dH2O to 1 mg/ml |
| ◆ Recombinant Proteins | ||
| CFP-7470Z | Recombinant Zebrafish CFP | +Inquiry |
| CFP-901H | Recombinant Human CFP protein, His-tagged | +Inquiry |
| Cfp-769M | Recombinant Mouse Cfp Protein, His-tagged | +Inquiry |
| CFP-2152M | Recombinant Mouse CFP Protein (23-464 aa), His-tagged | +Inquiry |
| CFP-7679H | Recombinant Human CFP protein, His & T7-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CFP-106H | Active Native Human Complement Factor P (Properdin) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CFP-7552HCL | Recombinant Human CFP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFP Products
Required fields are marked with *
My Review for All CFP Products
Required fields are marked with *
