Recombinant Cyan Fluorescent Protein, His-tagged
Cat.No. : | CFP-2906 |
Product Overview : | The recombinant CFP (Cyan Fluorescent Protein) is expressed in E. coli with an N-terminal His tag and purified by a method that ensures high purity and maximal CFP fluorescence. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyan |
Source : | E.coli |
Tag : | His |
Form : | Freeze dried |
Molecular Mass : | 31.3kDa |
AA Sequence : | MSGGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLAWGIQCFARY PEHMKMNDFFKSAMPEGYIQERTIHFQDDGKYKTRGEVKFEGDTLVNRVELKGEGFKEDGNILGHKLEYSAISD NVYIMPDKANNGLEANFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSCQSAISKDRNEARDHMVLLE SFSAYCHTHGMDELYRSGLRSRAQASNSAVDGTAGPGSTGSR |
Endotoxin : | <0.1>0.1> |
Purity : | ≥97% by SDS-PAGE and HPLC |
Applications : | Use as standards for SDS-PAGE, Western blot analysis of CFPtransfected cells, label other proteins, calibration of fluorometers and flow cytometers,fluorescence microscope, or microinjection of CFP into cells and tissues, etc. |
Storage : | -80 centigrade for long-term storage. |
Reconstitution : | Reconstitute with dH2O to 1 mg/ml |
◆ Recombinant Proteins | ||
CFP-211R | Recombinant Rhesus monkey CFP protein, His-tagged | +Inquiry |
CFP-252H | Recombinant Human CFP, His-tagged | +Inquiry |
CFP-210M | Recombinant Mouse CFP protein, His-tagged | +Inquiry |
Cfp-2691M | Recombinant Mouse Cfp protein, His-tagged | +Inquiry |
Cfp-770R | Recombinant Rat Cfp Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CFP-106H | Active Native Human Complement Factor P (Properdin) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFP-7552HCL | Recombinant Human CFP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFP Products
Required fields are marked with *
My Review for All CFP Products
Required fields are marked with *
0
Inquiry Basket