Recombinant Cynomolgus CXCL16 Protein, His-tagged
| Cat.No. : | CXCL16-253C |
| Product Overview : | Recombinant Cynomolgus CXCL16 Protein with His tag was expressed in E. coli. |
| Availability | November 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Monkey |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-223 aa |
| Description : | Enables chemokine activity. Involved in several processes, including positive regulation of cell growth; response to tumor necrosis factor; and response to type II interferon. Located in extracellular space. Biomarker of COVID-19 and systemic scleroderma. |
| AASequence : | MHHHHHHHHGGSGGSGSLSGSQSAAAPSPQTPRSPDVGQALGPGARLLLLLLLACLPPPGNGNEGTVTGSCHCSKRISSDSPPSAQFMNRLRKHLRAYHHCLHYIRFQLPSWSVCGGSKDPWVRELMSCLDLKECGHAYLGSVAHQEHLPPTSTPISQASEGASSDIRTPTQMLLSILQSTQRPTPPAGSLSLDKELTRPSETTIPTAGHSLGVGLEAGENQKQLKNNAGPTAGTSATVP |
| Molecular Mass : | 25 kDa |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 0.21 mg/mL by BCA |
| Gene ID | 58191 |
| Gene Name | CXCL16 C-X-C motif chemokine ligand 16 [ Homo sapiens (human) ] |
| Official Symbol | 58191 |
| Synonyms | CXCL16; C-X-C motif chemokine ligand 16; SRPSOX; CXCLG16; SR-PSOX; C-X-C motif chemokine 16; CXC chemokine ligand 16; chemokine (C-X-C motif) ligand 16; scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; small-inducible cytokine B16; transmembrane chemokine CXCL16 |
| mRNA Refseq | NM_001100812 |
| Official Symbol 2 | CXCL16 |
| Gene ID 2 | 58191 |
| Gene Name 2 | CXCL16 C-X-C motif chemokine ligand 16 [ Homo sapiens (human) ] |
| mRNA Refseq 2 | NM_001100812 |
| Protein Refseq 2 | NP_001094282 |
| MIM 2 | 605398 |
| UniProt ID 2 | Q9H2F6 |
| ◆ Recombinant Proteins | ||
| CXCL16-1688R | Recombinant Rat CXCL16 Protein | +Inquiry |
| Cxcl16-2095M | Recombinant Mouse Cxcl16 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cxcl16-7441R | Recombinant Rat Cxcl16 protein(Met1-Ala198), hFc-tagged | +Inquiry |
| Cxcl16-484M | Active Recombinant Mouse Chemokine (C-X-C motif) Ligand 16, His-tagged | +Inquiry |
| Cxcl16-883M | Recombinant Mouse Cxcl16 Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CXCL16-253C | Recombinant Cynomolgus CXCL16 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL16-1414RCL | Recombinant Rat CXCL16 cell lysate | +Inquiry |
| CXCL16-2545MCL | Recombinant Mouse CXCL16 cell lysate | +Inquiry |
| CXCL16-842CCL | Recombinant Canine CXCL16 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL16 Products
Required fields are marked with *
My Review for All CXCL16 Products
Required fields are marked with *
