Recombinant Cynomolgus CXCL16 Protein, His-tagged

Cat.No. : CXCL16-253C
Product Overview : Recombinant Cynomolgus CXCL16 Protein with His tag was expressed in E. coli.
Availability August 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Monkey
Source : E.coli
Tag : His
Protein Length : 1-223 aa
Description : Enables chemokine activity. Involved in several processes, including positive regulation of cell growth; response to tumor necrosis factor; and response to type II interferon. Located in extracellular space. Biomarker of COVID-19 and systemic scleroderma.
AASequence : MHHHHHHHHGGSGGSGSLSGSQSAAAPSPQTPRSPDVGQALGPGARLLLLLLLACLPPPGNGNEGTVTGSCHCSKRISSDSPPSAQFMNRLRKHLRAYHHCLHYIRFQLPSWSVCGGSKDPWVRELMSCLDLKECGHAYLGSVAHQEHLPPTSTPISQASEGASSDIRTPTQMLLSILQSTQRPTPPAGSLSLDKELTRPSETTIPTAGHSLGVGLEAGENQKQLKNNAGPTAGTSATVP
Molecular Mass : 25 kDa
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 0.21 mg/mL by BCA
Gene ID 58191
Gene Name CXCL16 C-X-C motif chemokine ligand 16 [ Homo sapiens (human) ]
Official Symbol 58191
Synonyms CXCL16; C-X-C motif chemokine ligand 16; SRPSOX; CXCLG16; SR-PSOX; C-X-C motif chemokine 16; CXC chemokine ligand 16; chemokine (C-X-C motif) ligand 16; scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; small-inducible cytokine B16; transmembrane chemokine CXCL16
mRNA Refseq NM_001100812
Official Symbol 2 CXCL16
Gene ID 2 58191
Gene Name 2 CXCL16 C-X-C motif chemokine ligand 16 [ Homo sapiens (human) ]
mRNA Refseq 2 NM_001100812
Protein Refseq 2 NP_001094282
MIM 2 605398
UniProt ID 2 Q9H2F6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL16 Products

Required fields are marked with *

My Review for All CXCL16 Products

Required fields are marked with *

0
cart-icon