Recombinant Cynomolgus CXCL16 Protein, His-tagged

• Cat.No.: CXCL16-253C
• Product Overview: Recombinant Cynomolgus CXCL16 Protein with His tag was expressed in E. coli.

Specification

• Species: Monkey
• Source: E.coli
• Tag: His
• Protein Length: 1-223 aa
• Description: Enables chemokine activity. Involved in several processes, including positive regulation of cell growth; response to tumor necrosis factor; and response to type II interferon. Located in extracellular space. Biomarker of COVID-19 and systemic scleroderma.
• AASequence: MHHHHHHHHGGSGGSGSLSGSQSAAAPSPQTPRSPDVGQALGPGARLLLLLLLACLPPPGNGNEGTVTGSCHCSKRISSDSPPSAQFMNRLRKHLRAYHHCLHYIRFQLPSWSVCGGSKDPWVRELMSCLDLKECGHAYLGSVAHQEHLPPTSTPISQASEGASSDIRTPTQMLLSILQSTQRPTPPAGSLSLDKELTRPSETTIPTAGHSLGVGLEAGENQKQLKNNAGPTAGTSATVP
• Molecular Mass: 25 kDa
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 0.21 mg/mL by BCA

Gene Information

• Gene Name 2: CXCL16 C-X-C motif chemokine ligand 16 [ Homo sapiens (human) ]
• Official Symbol 2: CXCL16
• Synonyms 2: CXCL16; C-X-C motif chemokine ligand 16; SRPSOX; CXCLG16; SR-PSOX; C-X-C motif chemokine 16; CXC chemokine ligand 16; chemokine (C-X-C motif) ligand 16; scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; small-inducible cytokine B16; transmembrane chemokine CXCL16
• Gene ID 2: 58191
• mRNA Refseq 2: NM_001100812
• Protein Refseq 2: NP_001094282
• MIM 2: 605398
• UniProt ID 2: Q9H2F6