Recombinant Cynomolgus IL1RN Protein, His-tagged

• Cat.No.: IL1RN-10C
• Product Overview: Recombinant Cynomolgus IL1RN Protein, fused to His-tag, was expressed in HEK293.

Specification

• Species: Cynomolgus
• Source: HEK293
• Tag: His
• Description: Protein coding
• Form: PBS, pH 7.4
• Molecular Mass: 17.9 kDa
• AA Sequence: RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDEHHHHHH
• Purity: ＞90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.85 mg/ml

Gene Information

• Gene Name: IL1RN interleukin 1 receptor antagonist [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: IL1RN
• Synonyms: DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA
• Gene ID: 701658
• mRNA Refseq: XM_015113137
• Protein Refseq: XP_014968623
• UniProt ID: F7HP64