Recombinant Full Length Cynomolgus Monkey insulin Protein, His tagged
Cat.No. : | INS-623C |
Product Overview : | Recombinant Full Length Cynomolgus Monkey insulin Protein (25-110 aa) with His tag was expressed in HEK293. |
Availability | September 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | His |
Protein Length : | 25-110 aa |
Description : | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. |
Molecular Mass : | 10.5 kDa |
AA Sequence : | FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDPQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCNHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 85 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | PBS, pH 7.4 |
Concentration : | 0.15 mg/mL |
Gene Name | INS insulin [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | INS |
Synonyms | INS; insulin; preproinsulin |
Gene ID | 704534 |
mRNA Refseq | XM_028833049 |
Protein Refseq | XP_028688882 |
UniProt ID | F7AUL3 |
◆ Recombinant Proteins | ||
INS-10B | Recombinant Bovine INS protein | +Inquiry |
INS-321H | Recombinant Human INS protein | +Inquiry |
INS-61H | Recombinant Human INS Protein | +Inquiry |
INS-1759H | Recombinant Human INS protein, His & T7-tagged | +Inquiry |
INS-5308H | Recombinant Human Insulin | +Inquiry |
◆ Native Proteins | ||
INS-5435B | Native Bovine Insulin | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
◆ Cell & Tissue Lysates | ||
INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *