Recombinant Full Length Cynomolgus Monkey insulin Protein, His tagged
| Cat.No. : | INS-623C |
| Product Overview : | Recombinant Full Length Cynomolgus Monkey insulin Protein (25-110 aa) with His tag was expressed in HEK293. |
| Availability | December 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 25-110 aa |
| Description : | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. |
| Molecular Mass : | 10.5 kDa |
| AA Sequence : | FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDPQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCNHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL. |
| Purity : | > 85 % by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | PBS, pH 7.4 |
| Concentration : | 0.15 mg/mL |
| Gene Name | INS insulin [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | INS |
| Synonyms | INS; insulin; preproinsulin |
| Gene ID | 704534 |
| mRNA Refseq | XM_028833049 |
| Protein Refseq | XP_028688882 |
| UniProt ID | F7AUL3 |
| ◆ Recombinant Proteins | ||
| INS-29H | Recombinant Human INS protein | +Inquiry |
| INS-2689C | Recombinant Chicken INS Protein, His-tagged | +Inquiry |
| INS-320H | Active Recombinant Human INS | +Inquiry |
| Ins-1783G | Recombinant Guinea pig Ins protein, His & SUMO-tagged | +Inquiry |
| INS-623C | Recombinant Full Length Cynomolgus Monkey insulin Protein, His tagged | +Inquiry |
| ◆ Native Proteins | ||
| INS-512D | Native Bovine INS | +Inquiry |
| INS-5435B | Native Bovine Insulin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *
