Recombinant Full Length Cynomolgus Monkey insulin Protein, His tagged

Cat.No. : INS-623C
Product Overview : Recombinant Full Length Cynomolgus Monkey insulin Protein (25-110 aa) with His tag was expressed in HEK293.
Availability June 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : HEK293
Tag : His
Protein Length : 25-110 aa
Description : Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Molecular Mass : 10.5 kDa
AA Sequence : FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDPQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCNHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 85 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : PBS, pH 7.4
Concentration : 0.15 mg/mL
Gene Name INS insulin [ Macaca mulatta (Rhesus monkey) ]
Official Symbol INS
Synonyms INS; insulin; preproinsulin
Gene ID 704534
mRNA Refseq XM_028833049
Protein Refseq XP_028688882
UniProt ID F7AUL3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INS Products

Required fields are marked with *

My Review for All INS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon