Recombinant Cynomolgus LILRB2 Protein, Biotinylated

• Cat.No.: LILRB2-01C
• Product Overview: Biotinylated Recombinant Cynomolgus LILRB2 Protein(XP_015297203.1) was expressed in HEK293.

Specification

• Species: Cynomolgus
• Source: HEK293
• Tag: Non
• Form: Supplied as a 0.2 μm filtered solution in PBS, pH 7.4
• Molecular Mass: ~ 53 kDa, reducing condition.
• AA Sequence: MTPILMVLICLGLSLGPRTHVQAGILPKPTLWAEPGSVISEGSPVTLRCQGSLQVQEYHLYREKNPASWVRQIRQELVKKGYFAIGFITWEHTGQYRCQYYSHSWWSEPSDPLELVVTGAYSKPTLSALPSPVVASGGNVTLQCDSQVAFDSFTLCKEGEDEHPQRLNCQSHARGWSWAVFSVGPVSPSRRWSYRCYGYISSAPNVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGDKLTLQCGSDAGYDRFALYKEGEGDFLQRPVRQPQAGLSQANFLLGPVSRSHGGQYRCSGAHNLSSEWSAPSDPLDILIAGQIRGRPFLSVQPGPKVVSGENVTLLCQSSWQFHAFLLTQAGAADAHLHLRSMYKYPKYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSVPSDPLELVVSGPSGGPSSPTTGPTSTCAGPEDQPLTPTGSAPQSGLGRHLGVGLNDIFEAQKIEWHEHHHHHHHHHH
• Endotoxin: Less than 1.0 EU per ug by the LAL method
• Purity: >85%, by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.1 mg/ml
• Conjugation: Biotin

Gene Information

• Gene Name: LOC102120967 leukocyte immunoglobulin-like receptor subfamily B member 2 [ Macaca fascicularis (crab-eating macaque) ]
• Official Symbol: LOC102120967
• Synonyms: LILRB2
• Gene ID: 102120967
• mRNA Refseq: XM_015441717.1
• Protein Refseq: XP_015297203.1