Recombinant Cynomolgus LILRB2 Protein, Biotinylated
| Cat.No. : | LILRB2-01C |
| Product Overview : | Biotinylated Recombinant Cynomolgus LILRB2 Protein(XP_015297203.1) was expressed in HEK293. |
| Availability | December 23, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Tag : | Non |
| Form : | Supplied as a 0.2 μm filtered solution in PBS, pH 7.4 |
| Molecular Mass : | ~ 53 kDa, reducing condition. |
| AA Sequence : | MTPILMVLICLGLSLGPRTHVQAGILPKPTLWAEPGSVISEGSPVTLRCQGSLQVQEYHLYREKNPASWVRQIRQELVKKGYFAIGFITWEHTGQYRCQYYSHSWWSEPSDPLELVVTGAYSKPTLSALPSPVVASGGNVTLQCDSQVAFDSFTLCKEGEDEHPQRLNCQSHARGWSWAVFSVGPVSPSRRWSYRCYGYISSAPNVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGDKLTLQCGSDAGYDRFALYKEGEGDFLQRPVRQPQAGLSQANFLLGPVSRSHGGQYRCSGAHNLSSEWSAPSDPLDILIAGQIRGRPFLSVQPGPKVVSGENVTLLCQSSWQFHAFLLTQAGAADAHLHLRSMYKYPKYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSVPSDPLELVVSGPSGGPSSPTTGPTSTCAGPEDQPLTPTGSAPQSGLGRHLGVGLNDIFEAQKIEWHEHHHHHHHHHH |
| Endotoxin : | Less than 1.0 EU per ug by the LAL method |
| Purity : | >85%, by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.1 mg/ml |
| Conjugation : | Biotin |
| Gene Name | LOC102120967 leukocyte immunoglobulin-like receptor subfamily B member 2 [ Macaca fascicularis (crab-eating macaque) ] |
| Official Symbol | LOC102120967 |
| Synonyms | LILRB2 |
| Gene ID | 102120967 |
| mRNA Refseq | XM_015441717.1 |
| Protein Refseq | XP_015297203.1 |
| ◆ Recombinant Proteins | ||
| LILRB2-7753H | Recombinant Human LILRB2 protein, mFc-tagged | +Inquiry |
| LILRB2-391H | Recombinant Human LILRB2 protein, hFc-tagged | +Inquiry |
| LILRB2-647H | Recombinant Human LILRB2 Protein, MYC/DDK-tagged | +Inquiry |
| LILRB2-4474H | Recombinant Human LILRB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LILRB2-202H | Recombinant Human LILRB2 protein, His-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LILRB2-1211HCL | Recombinant Human LILRB2 cell lysate | +Inquiry |
| LILRB2-1059HCL | Recombinant Human LILRB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRB2 Products
Required fields are marked with *
My Review for All LILRB2 Products
Required fields are marked with *
