Recombinant Cynomolgus LILRB2 Protein, Biotinylated
Cat.No. : | LILRB2-01C |
Product Overview : | Biotinylated Recombinant Cynomolgus LILRB2 Protein(XP_015297203.1) was expressed in HEK293. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | Non |
Form : | Supplied as a 0.2 μm filtered solution in PBS, pH 7.4 |
Molecular Mass : | ~ 53 kDa, reducing condition. |
AA Sequence : | MTPILMVLICLGLSLGPRTHVQAGILPKPTLWAEPGSVISEGSPVTLRCQGSLQVQEYHLYREKNPASWVRQIRQELVKKGYFAIGFITWEHTGQYRCQYYSHSWWSEPSDPLELVVTGAYSKPTLSALPSPVVASGGNVTLQCDSQVAFDSFTLCKEGEDEHPQRLNCQSHARGWSWAVFSVGPVSPSRRWSYRCYGYISSAPNVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGDKLTLQCGSDAGYDRFALYKEGEGDFLQRPVRQPQAGLSQANFLLGPVSRSHGGQYRCSGAHNLSSEWSAPSDPLDILIAGQIRGRPFLSVQPGPKVVSGENVTLLCQSSWQFHAFLLTQAGAADAHLHLRSMYKYPKYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSVPSDPLELVVSGPSGGPSSPTTGPTSTCAGPEDQPLTPTGSAPQSGLGRHLGVGLNDIFEAQKIEWHEHHHHHHHHHH |
Endotoxin : | Less than 1.0 EU per ug by the LAL method |
Purity : | >85%, by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.1 mg/ml |
Conjugation : | Biotin |
Gene Name | LOC102120967 leukocyte immunoglobulin-like receptor subfamily B member 2 [ Macaca fascicularis (crab-eating macaque) ] |
Official Symbol | LOC102120967 |
Synonyms | LILRB2 |
Gene ID | 102120967 |
mRNA Refseq | XM_015441717.1 |
Protein Refseq | XP_015297203.1 |
◆ Recombinant Proteins | ||
LILRB2-423HB | Recombinant Human LILRB2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
LILRB2-01C | Recombinant Cynomolgus LILRB2 Protein, Biotinylated | +Inquiry |
LILRB2-7753H | Recombinant Human LILRB2 protein, mFc-tagged | +Inquiry |
LILRB2-2188C | Recombinant Cynomolgus LILRB2 protein, His-tagged | +Inquiry |
LILRB2-581H | Recombinant Human LILRB2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRB2-1211HCL | Recombinant Human LILRB2 cell lysate | +Inquiry |
LILRB2-1059HCL | Recombinant Human LILRB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRB2 Products
Required fields are marked with *
My Review for All LILRB2 Products
Required fields are marked with *