Recombinant Cynomolgus monkey B2M Protein, His-tagged
| Cat.No. : | B2M-103C |
| Product Overview : | Recombinant Cynomolgus monkey B2M protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 119 |
| Description : | This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia. |
| Form : | Lyophilized |
| Molecular Mass : | 12.6 kDa |
| AA Sequence : | MSPSVALAVLALLSLSGLEAIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | B2M beta-2-microglobulin [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | B2M |
| Synonyms | B2M; beta-2-microglobulin; |
| Gene ID | 712428 |
| mRNA Refseq | NM_001047137 |
| Protein Refseq | NP_001040602 |
| UniProt ID | Q6V7J5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B2M Products
Required fields are marked with *
My Review for All B2M Products
Required fields are marked with *



