Recombinant Cynomolgus Monkey CD3G Protein (23-113 aa), His-tagged

Cat.No. : CD3G-2104C
Product Overview : Recombinant Cynomolgus Monkey CD3G Protein (23-113 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : Yeast
Tag : His
Protein Length : 23-113 aa
Description : The CD3 complex mediates signal transduction.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 12.5 kDa
AA Sequence : QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name CD3G CD3g molecule [ Macaca fascicularis (crab-eating macaque) ]
Official Symbol CD3G
Synonyms CD3G; T-cell receptor T3 gamma chain CD_antigen: CD3g;
Gene ID 102134381
mRNA Refseq NM_001283910
Protein Refseq NP_001270839
UniProt ID Q95LI7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD3G Products

Required fields are marked with *

My Review for All CD3G Products

Required fields are marked with *

0

Inquiry Basket

cartIcon