Recombinant Cynomolgus Monkey CD3G Protein (23-113 aa), His-tagged

• Cat.No.: CD3G-2104C
• Product Overview: Recombinant Cynomolgus Monkey CD3G Protein (23-113 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Cynomolgus
• Source: Yeast
• Tag: His
• Protein Length: 23-113 aa
• Description: The CD3 complex mediates signal transduction.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 12.5 kDa
• AA Sequence: QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: CD3G CD3g molecule [ Macaca fascicularis (crab-eating macaque) ]
• Official Symbol: CD3G
• Synonyms: CD3G; T-cell receptor T3 gamma chain CD_antigen: CD3g
• Gene ID: 102134381
• mRNA Refseq: NM_001283910
• Protein Refseq: NP_001270839
• UniProt ID: Q95LI7