Recombinant Cynomolgus Monkey CD3G Protein (23-113 aa), His-tagged
Cat.No. : | CD3G-2104C |
Product Overview : | Recombinant Cynomolgus Monkey CD3G Protein (23-113 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | Yeast |
Tag : | His |
Protein Length : | 23-113 aa |
Description : | The CD3 complex mediates signal transduction. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 12.5 kDa |
AA Sequence : | QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | CD3G CD3g molecule [ Macaca fascicularis (crab-eating macaque) ] |
Official Symbol | CD3G |
Synonyms | CD3G; T-cell receptor T3 gamma chain CD_antigen: CD3g; |
Gene ID | 102134381 |
mRNA Refseq | NM_001283910 |
Protein Refseq | NP_001270839 |
UniProt ID | Q95LI7 |
◆ Recombinant Proteins | ||
CD3G-4903H | Recombinant Human CD3G protein, Fc-tagged | +Inquiry |
CD3G-1251R | Recombinant Rat CD3G Protein | +Inquiry |
CD3G-4533H | Recombinant Human CD3G protein, His&Myc-tagged | +Inquiry |
CD3G-909R | Recombinant Rat CD3G Protein, His (Fc)-Avi-tagged | +Inquiry |
CD3G-5286H | Recombinant Human CD3G Protein (Met1-Ser116), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3G-7675HCL | Recombinant Human CD3G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3G Products
Required fields are marked with *
My Review for All CD3G Products
Required fields are marked with *