Recombinant Cynomolgus monkey CD80 Protein
| Cat.No. : | CD80-586C |
| Product Overview : | Recombinant Cynomolgus monkey CD80 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Protein Length : | 288 |
| Description : | The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy. |
| Form : | Lyophilized |
| Molecular Mass : | 25.8 kDa |
| AA Sequence : | MGHTWRQGISPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAISTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNETLRRESVRPI |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | CD80 CD80 molecule [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | CD80 |
| Synonyms | CD80; CD80 molecule; T-lymphocyte activation antigen CD80; B7.1; |
| Gene ID | 732518 |
| mRNA Refseq | NM_001042642 |
| Protein Refseq | NP_001036107 |
| UniProt ID | A0A8J8YFK0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD80 Products
Required fields are marked with *
My Review for All CD80 Products
Required fields are marked with *



