Recombinant Cynomolgus monkey CD80 Protein
Cat.No. : | CD80-586C |
Product Overview : | Recombinant Cynomolgus monkey CD80 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Protein Length : | 288 |
Description : | The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy. |
Form : | Lyophilized |
Molecular Mass : | 25.8 kDa |
AA Sequence : | MGHTWRQGISPSKCPYLKFFQLLVLACLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAISTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNETLRRESVRPI |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CD80 CD80 molecule [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | CD80 |
Synonyms | CD80; CD80 molecule; T-lymphocyte activation antigen CD80; B7.1; |
Gene ID | 732518 |
mRNA Refseq | NM_001042642 |
Protein Refseq | NP_001036107 |
UniProt ID | A0A8J8YFK0 |
◆ Recombinant Proteins | ||
CD80-185H | Recombinant Human CD80 Protein, C-His-tagged | +Inquiry |
CD80-591HAF488 | Recombinant Human CD80 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Cd80-6898MAF555 | Recombinant Mouse Cd80 Protein, hFc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Cd80-6898MAF647 | Recombinant Mouse Cd80 Protein, hFc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Cd80-5623M | Recombinant Mouse Cd80 Protein (Val38-Asn246), C-His tagged | +Inquiry |
◆ Native Proteins | ||
CD80-60H | Active Recombinant Human CD80 Protein, Flag&His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD80-2715HCL | Recombinant Human CD80 cell lysate | +Inquiry |
CD80-1767MCL | Recombinant Mouse CD80 cell lysate | +Inquiry |
CD80-948CCL | Recombinant Cynomolgus CD80 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD80 Products
Required fields are marked with *
My Review for All CD80 Products
Required fields are marked with *
0
Inquiry Basket