Recombinant Cynomolgus monkey CTLA4 Protein, Fc-tagged
| Cat.No. : | CTLA4-648C |
| Product Overview : | Recombinant Cynomolgus monkey CTLA4 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 223 |
| Description : | This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases. |
| Form : | Lyophilized |
| Molecular Mass : | 40 kDa |
| AA Sequence : | MACLGFQRHKARLNLATRTRPYTLLFSLLFIPVFSKAMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | CTLA4 cytotoxic T-lymphocyte-associated protein 4 [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | CTLA4 |
| Synonyms | CTLA4; cytotoxic T-lymphocyte-associated protein 4; cytotoxic T-lymphocyte protein 4; CD152 protein; cytotoxic T-lymphocyte protein 4 isoform CTLA4-TM; CTLA-4; |
| Gene ID | 705673 |
| mRNA Refseq | NM_001044739 |
| Protein Refseq | NP_001038204 |
| UniProt ID | A0A2K6E1V4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTLA4 Products
Required fields are marked with *
My Review for All CTLA4 Products
Required fields are marked with *



