Recombinant Cynomolgus monkey EPO protein, His-SUMO-tagged
| Cat.No. : | EPO-2861C |
| Product Overview : | Recombinant Cynomolgus monkey EPO protein(P07865)(28-192aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 28-192aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 34.2 kDa |
| AA Sequence : | APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Official Symbol | EPO |
| ◆ Recombinant Proteins | ||
| EPO-4238H | Recombinant Horse EPO protein, His-tagged | +Inquiry |
| EPO-002H | Active Recombinant Human EPO, HIgG1 Fc-tagged, mutant | +Inquiry |
| Epo-1433M | Recombinant Mouse Epo Protein, His&GST-tagged | +Inquiry |
| EPO-4401H | Recombinant Human EPO Protein, His (Fc)-Avi-tagged | +Inquiry |
| EPO-2862P | Recombinant Pig EPO protein, His-B2M-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPO-1450MCL | Recombinant Mouse EPO cell lysate | +Inquiry |
| EPO-592RCL | Recombinant Rat EPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPO Products
Required fields are marked with *
My Review for All EPO Products
Required fields are marked with *
