Recombinant Cynomolgus monkey IFNG protein, His-tagged
Cat.No. : | IFNG-6633C |
Product Overview : | Recombinant Cynomolgus monkey IFNG protein(P63309)(24-165aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-165a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ |
◆ Recombinant Proteins | ||
IFNG-15833H | Recombinant Human IFNG, His-tagged | +Inquiry |
IFNG-28243TH | Recombinant Human IFNG, His-tagged | +Inquiry |
Ifng-42M | Active Recombinant Mouse Ifng Protein (His23-Cys155), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IFNG-09H | Recombinant Human Interferon Gamma | +Inquiry |
IFNG-359C | Recombinant Cynomolgus Monkey IFNG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *