Recombinant Cynomolgus monkey LDLR Protein, His-tagged

Cat.No. : LDLR-345C
Product Overview : Recombinant Cynomolgus monkey LDLR protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : HEK293
Tag : His
Protein Length : 860
Description : The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. The encoded protein is normally bound at the cell membrane, where it binds low density lipoprotein/cholesterol and is taken into the cell. Lysosomes release the cholesterol, which is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. Alternate splicing results in multiple transcript variants.
Form : Lyophilized
Molecular Mass : 86.8 kDa
AA Sequence : MEPWGWKLRWTVAFLLAAAEAAVGDRCERNEFQCEDGKCISYKWVCDGTAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGEVDCENGSDEQDCPPKTCSQDEFRCHDGKCIYRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQHCQGLEVPKRDSSPCSAFEFHCRSGECIHSGWRCDGGPDCKDKSDEENCPVATCRPDEFQCSDGTCIHGSRQCDREYDCKDMSDEVGCINVTLCEGPNKFKCHSGECISLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHICNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGSYKCQCEEGFQLDPHTKACKAVGSIAYLIFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMIYSTQLDRAHSVSSYDTVISRDLQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIEWPNGITLDFPSGRLYWVDSKLHSISSIDVNGGNRKTVLEDKERLAHPFSLAIFEDKVFWTDIINEAIFSANRLTGSDINLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPQSPKFTCTCPDGMLLAKDMRSCLTEAEAAVATQETSTVRLMVSSKAVATQHTTTRPVPNTSQLPGATPGLTTAETVTMSHQALGDVAGRGNEKKPKSVGALSIVLPTVLLVFLCLGAFLLWKNWRLKSINSINFDNPVYQKTTEDEVHICRNQDGYSYPSRQMVSLEDDVA
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name LDLR low density lipoprotein receptor [ Callithrix jacchus ]
Official Symbol LDLR
Synonyms LDLR; low density lipoprotein receptor;
Gene ID 100385319
mRNA Refseq XM_035285437
Protein Refseq XP_035141328
UniProt ID F6W4Q9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LDLR Products

Required fields are marked with *

My Review for All LDLR Products

Required fields are marked with *

0
cart-icon