Recombinant Cynomolgus Monkey LEFTY1, His-tagged
Cat.No. : | LEFTY1-28C |
Product Overview : | Recombinant Cynomolgus Monkey LEFTY1, fused to His-tag, was expressed in HEK293. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | His |
Description : | left-right determination factor 1 |
Form : | 25mM Tris,150mM NaCl,pH 8.0. |
Molecular Mass : | 39.7 kDa |
AA Sequence : | LTGEQLLGSLLQQLQLSEAPVLDRADMEELVIPAHVRAQYVTLLQRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKATLHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKVFDVTEAVNFWQQLSRPRQPLLLQVSVQREHPGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPVTEGTRCCRQEMYIDLQGMKWADNWVLEPPGFLAYECVGTCQQPPEALAFKWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRGLQPDDDDKHHHHHH |
Endotoxin : | <1EU/ug by LAL. |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.25mg/ml |
Gene Name | LOC102143175 left-right determination factor 1 [ Macaca fascicularis (crab-eating macaque) ] |
Official Symbol | LEFTY1 |
Synonyms | LOC102143175 |
Gene ID | 102143175 |
mRNA Refseq | XM_005540998 |
Protein Refseq | XP_005541055 |
UniProt ID | A0A2K5X4B9 |
◆ Recombinant Proteins | ||
Lefty1-10587M | Recombinant Mouse Lefty1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lefty1-1765M | Recombinant Mouse Left Right Determination Factor 1 | +Inquiry |
LEFTY1-3923H | Recombinant Human LEFTY1 Protein (Phe78-Pro361), His tagged | +Inquiry |
Lefty1-629M | Active Recombinant Mouse Lefty1 | +Inquiry |
Lefty1-1915H | Active Recombinant Human Left-right Determination Factor 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEFTY1-980HCL | Recombinant Human LEFTY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEFTY1 Products
Required fields are marked with *
My Review for All LEFTY1 Products
Required fields are marked with *