Recombinant Cynomolgus Monkey LEFTY1, His-tagged
| Cat.No. : | LEFTY1-28C |
| Product Overview : | Recombinant Cynomolgus Monkey LEFTY1, fused to His-tag, was expressed in HEK293. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Tag : | His |
| Description : | left-right determination factor 1 |
| Form : | 25mM Tris,150mM NaCl,pH 8.0. |
| Molecular Mass : | 39.7 kDa |
| AA Sequence : | LTGEQLLGSLLQQLQLSEAPVLDRADMEELVIPAHVRAQYVTLLQRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKATLHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKVFDVTEAVNFWQQLSRPRQPLLLQVSVQREHPGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPVTEGTRCCRQEMYIDLQGMKWADNWVLEPPGFLAYECVGTCQQPPEALAFKWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRGLQPDDDDKHHHHHH |
| Endotoxin : | <1EU/ug by LAL. |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.25mg/ml |
| Gene Name | LOC102143175 left-right determination factor 1 [ Macaca fascicularis (crab-eating macaque) ] |
| Official Symbol | LEFTY1 |
| Synonyms | LOC102143175 |
| Gene ID | 102143175 |
| mRNA Refseq | XM_005540998 |
| Protein Refseq | XP_005541055 |
| UniProt ID | A0A2K5X4B9 |
| ◆ Recombinant Proteins | ||
| LEFTY1-003H | Recombinant Human LEFTY1 Protein, Fc-tagged | +Inquiry |
| Lefty1-1915H | Active Recombinant Human Left-right Determination Factor 1 | +Inquiry |
| LEFTY1-27R | Recombinant Rat LEFTY1, His-tagged | +Inquiry |
| LEFTY1-5033M | Recombinant Mouse LEFTY1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LEFTY1-367H | Recombinant Human LEFTY1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LEFTY1-980HCL | Recombinant Human LEFTY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEFTY1 Products
Required fields are marked with *
My Review for All LEFTY1 Products
Required fields are marked with *
