Recombinant Cynomolgus Monkey LEFTY1, His-tagged

• Cat.No.: LEFTY1-28C
• Product Overview: Recombinant Cynomolgus Monkey LEFTY1, fused to His-tag, was expressed in HEK293.

Specification

• Species: Cynomolgus
• Source: HEK293
• Tag: His
• Description: left-right determination factor 1
• Form: 25mM Tris,150mM NaCl，pH 8.0.
• Molecular Mass: 39.7 kDa
• AA Sequence: LTGEQLLGSLLQQLQLSEAPVLDRADMEELVIPAHVRAQYVTLLQRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKATLHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKVFDVTEAVNFWQQLSRPRQPLLLQVSVQREHPGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPVTEGTRCCRQEMYIDLQGMKWADNWVLEPPGFLAYECVGTCQQPPEALAFKWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRGLQPDDDDKHHHHHH
• Endotoxin: ＜1EU/ug by LAL.
• Purity: ＞90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.25mg/ml

Gene Information

• Gene Name: LOC102143175 left-right determination factor 1 [ Macaca fascicularis (crab-eating macaque) ]
• Official Symbol: LEFTY1
• Synonyms: LOC102143175
• Gene ID: 102143175
• mRNA Refseq: XM_005540998
• Protein Refseq: XP_005541055
• UniProt ID: A0A2K5X4B9