Recombinant Cynomolgus Monkey LEFTY1 Protein, His-tagged
| Cat.No. : | LEFTY1-16C |
| Product Overview : | Recombinant Cynomolgus Monkey LEFTY1 Protein, fused to His-tag, was expressed in HEK293T. |
| Availability | June 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Tag : | His |
| Description : | left-right determination factor 1 |
| Form : | 25mM Tris, 150mM NaCl, pH 8.0. |
| Molecular Mass : | 39.7 kDa |
| AA Sequence : | LTGEQLLGSLLQQLQLSEAPVLDRADMEELVIPAHVRAQYVTLLQRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKATLHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKVFDVTEAVNFWQQLSRPRQPLLLQVSVQREHPGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPVTEGTRCCRQEMYIDLQGMKWADNWVLEPPGFLAYECVGTCQQPPEALAFKWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRGLQPDDDDKHHHHHH |
| Endotoxin : | <1EU/ug by LAL |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.25 mg/ml |
| Gene Name | LOC102143175 left-right determination factor 1 [ Macaca fascicularis (crab-eating macaque) ] |
| Official Symbol | LEFTY1 |
| Synonyms | LOC102143175 |
| Gene ID | 102143175 |
| mRNA Refseq | XM_005540998.3 |
| Protein Refseq | XP_005541055.1 |
| UniProt ID | A0A2K5X4B9 |
| ◆ Recombinant Proteins | ||
| LEFTY1-16C | Recombinant Cynomolgus Monkey LEFTY1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOC102143175 Products
Required fields are marked with *
My Review for All LOC102143175 Products
Required fields are marked with *
