Recombinant Cynomolgus monkey LIF protein, His-tagged
Cat.No. : | LIF-4664C |
Product Overview : | Recombinant Cynomolgus monkey LIF protein(A0A2K5UCA8)(23-202 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus monkey |
Source : | Yeast |
Tag : | His |
Protein Length : | 23-202 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 21.2 kDa |
AASequence : | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKETIAVLAQAF |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
◆ Recombinant Proteins | ||
LIF-134H | Active Recombinant Human LIF protein, His-tagged | +Inquiry |
Lif-1739R | Recombinant Rat Lif Protein, His-tagged | +Inquiry |
LIF-6754H | Recombinant Human LIF protein | +Inquiry |
Lif-679M | Recombinant Mouse Lif protein, His-tagged | +Inquiry |
LIF-7733H | Recombinant Human LIF protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
LIF-1071HCL | Recombinant Human LIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIF Products
Required fields are marked with *
My Review for All LIF Products
Required fields are marked with *