Recombinant Cynomolgus Monkey SNCG Protein (1-127 aa)

Cat.No. : SNCG-2456C
Product Overview : Recombinant Cynomolgus Monkey SNCG Protein (1-127 aa) is produced by E. coli expression system. Research Area: Neuroscience. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : E.coli
Tag : Non
Protein Length : 1-127 aa
Description : Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 13.3 kDa
AA Sequence : MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAVVSSVNTVAAKTVEEAENIAVTSGVVRKEDLKPSAPQQEGEAAKEKEEVAEEAQSGGD
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name SNCG synuclein gamma [ Macaca fascicularis (crab-eating macaque) ]
Official Symbol SNCG
Synonyms SNCG;
Gene ID 102121834
mRNA Refseq NM_001283870
Protein Refseq NP_001270799
UniProt ID Q2PFW6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNCG Products

Required fields are marked with *

My Review for All SNCG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon