Recombinant Cynomolgus Monkey SNCG Protein (1-127 aa)

• Cat.No.: SNCG-2456C
• Product Overview: Recombinant Cynomolgus Monkey SNCG Protein (1-127 aa) is produced by E. coli expression system. Research Area: Neuroscience. Protein Description: Full Length.

Specification

• Species: Cynomolgus
• Source: E.coli
• Tag: Non
• Protein Length: 1-127 aa
• Description: Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 13.3 kDa
• AA Sequence: MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAVVSSVNTVAAKTVEEAENIAVTSGVVRKEDLKPSAPQQEGEAAKEKEEVAEEAQSGGD
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: SNCG synuclein gamma [ Macaca fascicularis (crab-eating macaque) ]
• Official Symbol: SNCG
• Synonyms: SNCG
• Gene ID: 102121834
• mRNA Refseq: NM_001283870
• Protein Refseq: NP_001270799
• UniProt ID: Q2PFW6