Recombinant Cynomolgus Monkey SNCG Protein (1-127 aa)
Cat.No. : | SNCG-2456C |
Product Overview : | Recombinant Cynomolgus Monkey SNCG Protein (1-127 aa) is produced by E. coli expression system. Research Area: Neuroscience. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-127 aa |
Description : | Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 13.3 kDa |
AA Sequence : | MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAVVSSVNTVAAKTVEEAENIAVTSGVVRKEDLKPSAPQQEGEAAKEKEEVAEEAQSGGD |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SNCG synuclein gamma [ Macaca fascicularis (crab-eating macaque) ] |
Official Symbol | SNCG |
Synonyms | SNCG; |
Gene ID | 102121834 |
mRNA Refseq | NM_001283870 |
Protein Refseq | NP_001270799 |
UniProt ID | Q2PFW6 |
◆ Recombinant Proteins | ||
SNCG-2840H | Recombinant Human SNCG protein, GST-tagged | +Inquiry |
SNCG-6327H | Recombinant Human SNCG Protein (Met1-Ala122), N-GST tagged | +Inquiry |
SNCG-5640R | Recombinant Rat SNCG Protein | +Inquiry |
SNCG-693C | Recombinant Cynomolgus Monkey SNCG Protein, His (Fc)-Avi-tagged | +Inquiry |
SNCG-4183R | Recombinant Rhesus Macaque SNCG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCG-1654HCL | Recombinant Human SNCG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCG Products
Required fields are marked with *
My Review for All SNCG Products
Required fields are marked with *
0
Inquiry Basket