Recombinant Cynomolgus monkey TGFBR2 Protein, Fc&avi tagged, Biotinylated
| Cat.No. : | TGFBR2-001CB |
| Product Overview : | Biotinylated recombinant Cynomolgus monkey TGFBR2 Protein (24-159 aa) with Fc&avi tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus monkey |
| Source : | HEK293 |
| Tag : | Avi&Fc |
| Protein Length : | 24-159 aa |
| Conjugation/Label : | Biotin |
| Description : | Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways. |
| Molecular Mass : | 44 kDa |
| AASequence : | IPPHVQKSVNNDMMVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCLSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE |
| Endotoxin : | <1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 2.05 mg/mL by BCA |
| Storage Buffer : | Sterile PBS, pH 7.4 |
| Labeling efficiency : | 0.71 By HABA |
| Gene Name | TGFBR2 transforming growth factor beta receptor 2 [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | TGFBR2 |
| Synonyms | TGFBR2; transforming growth factor beta receptor 2; TGF-beta receptor type-2; transforming growth factor, beta receptor II (70/80kDa); EC 2.7.11.30 |
| Gene ID | 703088 |
| mRNA Refseq | NM_001261151 |
| Protein Refseq | NP_001248080 |
| UniProt ID | H9YUL0 |
| ◆ Recombinant Proteins | ||
| TGFBR2-377H | Active Recombinant Human TGFBR2 protein(Met1-Gln166), His-tagged | +Inquiry |
| TGFBR2-8814R | Active Recombinant Rhesus TGFBR2, Fc tagged | +Inquiry |
| TGFBR2-151H | Recombinant Human TGFBR2, Fc Chimera | +Inquiry |
| TGFBR2-173H | Recombinant Human TGFBR2 protein, hFc-tagged | +Inquiry |
| TGFBR2-002CB | Recombinant Cynomolgus monkey TGFBR2 Protein, His&avi tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TGFBR2-1374RCL | Recombinant Rat TGFBR2 cell lysate | +Inquiry |
| TGFBR2-1291CCL | Recombinant Cynomolgus TGFBR2 cell lysate | +Inquiry |
| TGFBR2-2842HCL | Recombinant Human TGFBR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFBR2 Products
Required fields are marked with *
My Review for All TGFBR2 Products
Required fields are marked with *
