Recombinant Cynomolgus monkey TIGIT Protein, Fc-tagged
| Cat.No. : | TIGIT-726C |
| Product Overview : | Recombinant Cynomolgus monkey TIGIT protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 312 |
| Description : | This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses. |
| Form : | Lyophilized |
| Molecular Mass : | 40 kDa |
| AA Sequence : | MAFLVAPPMQFVYLLKTLCVFNMVFAKLGFSETVFSHRLSFTVLSAVGYFRWQKRPHLLPVSPLGRSMRWCLFLIWAQGLRQAPLASGMMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIPLLGAMAMMLVVICIAVIVVVVLARKKKSLRIHSVESGLQRKSTGQEEQIPSAPSPPGSCVQAEAAPAGLCGEQQGDDCAELHDYFNVLSYRSLGSCSFFTETG |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | TIGIT T cell immunoreceptor with Ig and ITIM domains [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | TIGIT |
| Synonyms | TIGIT; T cell immunoreceptor with Ig and ITIM domains; T-cell immunoreceptor with Ig and ITIM domains; T-cell immunoreceptor with Ig and ITIM domain protein |
| Gene ID | 710941 |
| mRNA Refseq | XM_015129816 |
| Protein Refseq | XP_014985302 |
| UniProt ID | A0A5F8AKQ5 |
| ◆ Recombinant Proteins | ||
| TIGIT-106H | Recombinant Human TIGIT protein, His-tagged | +Inquiry |
| TIGIT-107H | Recombinant Human TIGIT protein, hFc-tagged | +Inquiry |
| Tigit-2348MAF555 | Recombinant Mouse Tigit Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| TIGIT-12H | Recombinant Human TIGIT Protein, C-6His-Avi tagged, Biotinylated | +Inquiry |
| TIGIT-0631H | Active Recombinant Human TIGIT protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
| ◆ Native Proteins | ||
| Tigit-59M | Active Recombinant Mouse TIGIT Homodimer Protein, Fc tagged | +Inquiry |
| TIGIT-61R | Active Recombinant Rhesus Macaque TIGIT Homodimer Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TIGIT-1420MCL | Recombinant Mouse TIGIT cell lysate | +Inquiry |
| TIGIT-2610HCL | Recombinant Human TIGIT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIGIT Products
Required fields are marked with *
My Review for All TIGIT Products
Required fields are marked with *
