Recombinant Cynomolgus monkey TNFRSF9 Protein

Cat.No. : TNFRSF9-579C
Product Overview : Recombinant Cynomolgus monkey TNFRSF9 protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : HEK293
Protein Length : 254
Description : The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB.
Form : Lyophilized
Molecular Mass : 19.2 kDa
AA Sequence : MGNSCYNIVATLLLVLNFERTRSLQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQIIFFLALTSTVVLFLLFFLVLRFSVVKRSRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name TNFRSF9 tumor necrosis factor receptor superfamily, member 9 [ Macaca mulatta (Rhesus monkey) ]
Official Symbol TNFRSF9
Synonyms TNFRSF9; tumor necrosis factor receptor superfamily, member 9; tumor necrosis factor receptor superfamily member 9;
Gene ID 708281
mRNA Refseq NM_001266128
Protein Refseq NP_001253057
UniProt ID A0A2K6CFS1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF9 Products

Required fields are marked with *

My Review for All TNFRSF9 Products

Required fields are marked with *

0
cart-icon