Recombinant Cynomolgus PGLYRP1 Protein, His-tagged
| Cat.No. : | PGLYRP1-787C |
| Product Overview : | Recombinant Cynomolgus PGLYRP1 protein(NP_001270233.1), fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Tag : | His |
| Form : | Supplied as a 0.2 μm filtered solution in PBS (pH 7.4) |
| Molecular Mass : | The protein has a calculated MW of 21 kDa. |
| AA Sequence : | MSRRCALLAWALLGLLRLGEAQKTEAPACCSPIVPRNEWRALQSECTQRLSLPLHYVVVSHTAGSSCNTPALCQQQTQNVQSYHVKTLHWCDVGYNFLIGEDGLVYEGRGWNFTGAHADHVWNTMSIGISFMGNYMDRVPLPRALRAAQGLLACGVAQGALKSNYVLKGHRDVQRTLSPGDQLYNLIQNWPHYPSH |
| Endotoxin : | <1EU per ug (determined by the LAL method) |
| Purity : | ≥90% as determined by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.18 mg/ml |
| Gene Name | PGLYRP1 peptidoglycan recognition protein 1 [ Macaca fascicularis (crab-eating macaque) ] |
| Official Symbol | PGLYRP1 |
| Synonyms | PGRP-S; PGLYRP1 |
| Gene ID | 102117154 |
| mRNA Refseq | NM_001283304.1 |
| Protein Refseq | NP_001270233.1 |
| UniProt ID | Q18ND3 |
| ◆ Recombinant Proteins | ||
| Pglyrp1-1073R | Recombinant Rat Pglyrp1 protein, His & T7-tagged | +Inquiry |
| PGLYRP1-4408R | Recombinant Rat PGLYRP1 Protein | +Inquiry |
| Pglyrp1-6666M | Recombinant Mouse Pglyrp1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PGLYRP1-06H | Active Recombinant Human PGLYRP1 Protein, His-tagged | +Inquiry |
| PGLYRP1-3838H | Recombinant Human PGLYRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PGLYRP1-1873MCL | Recombinant Mouse PGLYRP1 cell lysate | +Inquiry |
| PGLYRP1-1339HCL | Recombinant Human PGLYRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGLYRP1 Products
Required fields are marked with *
My Review for All PGLYRP1 Products
Required fields are marked with *
