Recombinant Cynomolgus PGLYRP1 Protein, His-tagged
Cat.No. : | PGLYRP1-787C |
Product Overview : | Recombinant Cynomolgus PGLYRP1 protein(NP_001270233.1), fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | His |
Form : | Supplied as a 0.2 μm filtered solution in PBS (pH 7.4) |
Molecular Mass : | The protein has a calculated MW of 21 kDa. |
AA Sequence : | MSRRCALLAWALLGLLRLGEAQKTEAPACCSPIVPRNEWRALQSECTQRLSLPLHYVVVSHTAGSSCNTPALCQQQTQNVQSYHVKTLHWCDVGYNFLIGEDGLVYEGRGWNFTGAHADHVWNTMSIGISFMGNYMDRVPLPRALRAAQGLLACGVAQGALKSNYVLKGHRDVQRTLSPGDQLYNLIQNWPHYPSH |
Endotoxin : | <1EU per ug (determined by the LAL method) |
Purity : | ≥90% as determined by SDS-PAGE |
Storage : | Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.18 mg/ml |
Gene Name | PGLYRP1 peptidoglycan recognition protein 1 [ Macaca fascicularis (crab-eating macaque) ] |
Official Symbol | PGLYRP1 |
Synonyms | PGRP-S; PGLYRP1 |
Gene ID | 102117154 |
mRNA Refseq | NM_001283304.1 |
Protein Refseq | NP_001270233.1 |
UniProt ID | Q18ND3 |
◆ Recombinant Proteins | ||
Pglyrp1-1052M | Active Recombinant Mouse Pglyrp1 Protein, His-tagged | +Inquiry |
PGLYRP1-787C | Recombinant Cynomolgus PGLYRP1 Protein, His-tagged | +Inquiry |
Pglyrp1-570M | Active Recombinant Mouse Pglyrp1, His-tagged | +Inquiry |
Pglyrp1-1072M | Recombinant Mouse Pglyrp1 protein, His-tagged | +Inquiry |
PGLYRP1-1207H | Recombinant Human PGLYRP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGLYRP1-1873MCL | Recombinant Mouse PGLYRP1 cell lysate | +Inquiry |
PGLYRP1-1339HCL | Recombinant Human PGLYRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGLYRP1 Products
Required fields are marked with *
My Review for All PGLYRP1 Products
Required fields are marked with *