Recombinant Cynomolgus PGLYRP1 Protein, His-tagged

• Cat.No.: PGLYRP1-787C
• Product Overview: Recombinant Cynomolgus PGLYRP1 protein(NP_001270233.1), fused to His-tag, was expressed in HEK293.

Specification

• Species: Cynomolgus
• Source: HEK293
• Tag: His
• Form: Supplied as a 0.2 μm filtered solution in PBS (pH 7.4)
• Molecular Mass: The protein has a calculated MW of 21 kDa.
• AA Sequence: MSRRCALLAWALLGLLRLGEAQKTEAPACCSPIVPRNEWRALQSECTQRLSLPLHYVVVSHTAGSSCNTPALCQQQTQNVQSYHVKTLHWCDVGYNFLIGEDGLVYEGRGWNFTGAHADHVWNTMSIGISFMGNYMDRVPLPRALRAAQGLLACGVAQGALKSNYVLKGHRDVQRTLSPGDQLYNLIQNWPHYPSH
• Endotoxin: <1EU per ug (determined by the LAL method)
• Purity: ≥90% as determined by SDS-PAGE
• Storage: Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.18 mg/ml

Gene Information

• Gene Name: PGLYRP1 peptidoglycan recognition protein 1 [ Macaca fascicularis (crab-eating macaque) ]
• Official Symbol: PGLYRP1
• Synonyms: PGRP-S; PGLYRP1
• Gene ID: 102117154
• mRNA Refseq: NM_001283304.1
• Protein Refseq: NP_001270233.1
• UniProt ID: Q18ND3