Recombinant Cynomolgus PGLYRP1 Protein, His-tagged

Cat.No. : PGLYRP1-787C
Product Overview : Recombinant Cynomolgus PGLYRP1 protein(NP_001270233.1), fused to His-tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : HEK293
Tag : His
Form : Supplied as a 0.2 μm filtered solution in PBS (pH 7.4)
Molecular Mass : The protein has a calculated MW of 21 kDa.
AA Sequence : MSRRCALLAWALLGLLRLGEAQKTEAPACCSPIVPRNEWRALQSECTQRLSLPLHYVVVSHTAGSSCNTPALCQQQTQNVQSYHVKTLHWCDVGYNFLIGEDGLVYEGRGWNFTGAHADHVWNTMSIGISFMGNYMDRVPLPRALRAAQGLLACGVAQGALKSNYVLKGHRDVQRTLSPGDQLYNLIQNWPHYPSH
Endotoxin : <1EU per ug (determined by the LAL method)
Purity : ≥90% as determined by SDS-PAGE
Storage : Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.18 mg/ml
Gene Name PGLYRP1 peptidoglycan recognition protein 1 [ Macaca fascicularis (crab-eating macaque) ]
Official Symbol PGLYRP1
Synonyms PGRP-S; PGLYRP1
Gene ID 102117154
mRNA Refseq NM_001283304.1
Protein Refseq NP_001270233.1
UniProt ID Q18ND3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PGLYRP1 Products

Required fields are marked with *

My Review for All PGLYRP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon