Recombinant Cynomolgus SOD1 Protein, His-tagged

Cat.No. : SOD1-957C
Product Overview : Recombinant Cynomolgus SOD1 protein with a His-tag was expressed in HEK293
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : HEK293
Tag : His
Description : Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
Molecular Mass : The protein has a calculated MW of 16.7 kDa.
AA Sequence : AMKAVCVLKGDSPVQGTINFEQKESNGPVKVWGSITGLTEGLHGFHVHQFGDNTQGCTSAGPHFNPLSRQHGGPKDEERHVGDLGNVTAGKDGVAKVSFEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESKKTGNAGGRLACGVIGIAQHHHHHH
Endotoxin : <1 EU/μg
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.24 mg/mL
Storage Buffer : PBS, pH 7.4
Gene Name SOD1 superoxide dismutase 1, soluble [ Macaca mulatta (Rhesus monkey) ]
Official Symbol SOD1
Synonyms SOD1; superoxide dismutase 1, soluble; superoxide dismutase [Cu-Zn]; Cu,Zn-superoxide dismutase; superoxide dismutase 1, soluble (amyotrophic lateral sclerosis 1 (adult));
Gene ID 574096
mRNA Refseq NM_001032804
Protein Refseq NP_001027976
UniProt ID Q8HXQ1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SOD1 Products

Required fields are marked with *

My Review for All SOD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon