Recombinant Cynomolgus SOD1 Protein, His-tagged
Cat.No. : | SOD1-957C |
Product Overview : | Recombinant Cynomolgus SOD1 protein with a His-tag was expressed in HEK293 |
Availability | September 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | His |
Description : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. |
Molecular Mass : | The protein has a calculated MW of 16.7 kDa. |
AA Sequence : | AMKAVCVLKGDSPVQGTINFEQKESNGPVKVWGSITGLTEGLHGFHVHQFGDNTQGCTSAGPHFNPLSRQHGGPKDEERHVGDLGNVTAGKDGVAKVSFEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESKKTGNAGGRLACGVIGIAQHHHHHH |
Endotoxin : | <1 EU/μg |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.24 mg/mL |
Storage Buffer : | PBS, pH 7.4 |
Gene Name | SOD1 superoxide dismutase 1, soluble [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | SOD1 |
Synonyms | SOD1; superoxide dismutase 1, soluble; superoxide dismutase [Cu-Zn]; Cu,Zn-superoxide dismutase; superoxide dismutase 1, soluble (amyotrophic lateral sclerosis 1 (adult)); |
Gene ID | 574096 |
mRNA Refseq | NM_001032804 |
Protein Refseq | NP_001027976 |
UniProt ID | Q8HXQ1 |
◆ Recombinant Proteins | ||
Sod1-4632R | Recombinant Rat Sod1 protein, His-SUMO-tagged | +Inquiry |
SOD1-2020C | Recombinant Cattle SOD1 protein, His-tagged | +Inquiry |
SOD1-103H | Active Recombinant Human SOD1, low endotoxin | +Inquiry |
Sod1-2026R | Recombinant Rat Sod1 protein, His-tagged | +Inquiry |
SOD1-699C | Recombinant Cynomolgus Monkey SOD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CED026 | Active Bovine Superoxide Dismutase (SOD), High Purity >95% | +Inquiry |
SOD1-102B | Active Native Bovine SOD, modified | +Inquiry |
SOD1-101B | Active Native Bovine SOD | +Inquiry |
SOD1-1570H | Active Recombinant Human SOD1 Protein, Animal Free, Beta-lactam Antibiotics Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOD1-1576HCL | Recombinant Human SOD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOD1 Products
Required fields are marked with *
My Review for All SOD1 Products
Required fields are marked with *