Recombinant Cynomolgus TTR Protein, His-tagged

• Cat.No.: TTR-1059C
• Product Overview: Recombinant Cynomolgus TTR protein with a His-tag was expressed in HEK293

Specification

• Species: Cynomolgus
• Source: HEK293
• Tag: His
• Description: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
• Molecular Mass: The protein has a calculated MW of 14.6 kDa.
• AA Sequence: GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKEHHHHHH
• Endotoxin: <1 EU/μg
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.32 mg/mL
• Storage Buffer: PBS pH7.4

Gene Information

• Gene Name: TTR transthyretin [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: TTR
• Synonyms: TTR; transthyretin; transthyretin (prealbumin, amyloidosis type I)
• Gene ID: 705943
• mRNA Refseq: NM_001261679
• Protein Refseq: NP_001248608
• UniProt ID: Q8HXW1