Recombinant Cynomolgus TTR Protein, His-tagged
Cat.No. : | TTR-1059C |
Product Overview : | Recombinant Cynomolgus TTR protein with a His-tag was expressed in HEK293 |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | His |
Description : | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. |
Molecular Mass : | The protein has a calculated MW of 14.6 kDa. |
AA Sequence : | GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKEHHHHHH |
Endotoxin : | <1 EU/μg |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.32 mg/mL |
Storage Buffer : | PBS pH7.4 |
Gene Name | TTR transthyretin [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | TTR |
Synonyms | TTR; transthyretin; transthyretin (prealbumin, amyloidosis type I); |
Gene ID | 705943 |
mRNA Refseq | NM_001261679 |
Protein Refseq | NP_001248608 |
UniProt ID | Q8HXW1 |
◆ Recombinant Proteins | ||
TTR-2774H | Recombinant Human TTR Protein, His-tagged | +Inquiry |
TTR-1837H | Recombinant Human Transthyretin | +Inquiry |
TTR-802C | Recombinant Cynomolgus Monkey TTR Protein, His (Fc)-Avi-tagged | +Inquiry |
Ttr-3632M | Recombinant Mouse Ttr protein, GST-tagged | +Inquiry |
TTR-6215H | Recombinant Human TTR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
TTR-254H | Native Human Prealbumin | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
TTR-141S | Native Sheep prealbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTR Products
Required fields are marked with *
My Review for All TTR Products
Required fields are marked with *