Recombinant Dog ANGPT2 protein(19-495aa), His-tagged
Cat.No. : | ANGPT2-964D |
Product Overview : | Recombinant Dog ANGPT2 protein(A0A8J8)(19-495aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-495aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 55.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | YNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLTFPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVFQVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF |
Gene Name | ANGPT2 angiopoietin 2 [ Canis lupus familiaris ] |
Official Symbol | ANGPT2 |
Synonyms | ANGPT2; angiopoietin 2; angiopoietin-2; ANG-2; |
Gene ID | 607616 |
mRNA Refseq | NM_001048126 |
Protein Refseq | NP_001041591 |
◆ Recombinant Proteins | ||
ANGPT2-315R | Active Recombinant Rabbit ANGPT2 protein, His-tagged | +Inquiry |
ANGPT2-484H | Recombinant Human ANGPT2 Protein | +Inquiry |
ANGPT2-244H | Active Recombinant Human ANGPT2 protein, His-tagged | +Inquiry |
ANGPT2-1034HF | Recombinant Full Length Human ANGPT2 Protein, GST-tagged | +Inquiry |
Angpt2-2163M | Active Recombinant Mouse Angpt2 Protein, C-6×His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPT2-2228HCL | Recombinant Human ANGPT2 cell lysate | +Inquiry |
ANGPT2-001MCL | Recombinant Mouse ANGPT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANGPT2 Products
Required fields are marked with *
My Review for All ANGPT2 Products
Required fields are marked with *
0
Inquiry Basket