Recombinant Dog Anionic Trypsin Protein, His-SUMO-tagged
| Cat.No. : | TRY2-1121D |
| Product Overview : | Recombinant Dog Anionic Trypsin Protein (24-247aa) was expressed in E. coli with His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 24-247 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 40.0 kDa |
| AA Sequence : | IVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLNARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQITENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQSTIAANS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Anionic trypsin |
| Official Symbol | Anionic trypsin |
| Synonyms | Anionic trypsin; EC 3.4.21.4; TRY2; TRY2_CANLF |
| UniProt ID | P06872 |
| ◆ Recombinant Proteins | ||
| Anionic trypsin-4128D | Recombinant Dog Anionic trypsin protein, His-SUMO-tagged | +Inquiry |
| TRY2-1121D | Recombinant Dog Anionic Trypsin Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Anionic trypsin Products
Required fields are marked with *
My Review for All Anionic trypsin Products
Required fields are marked with *



