Recombinant Dog ATOX1 protein, His-tagged
Cat.No. : | ATOX1-4564D |
Product Overview : | Recombinant Dog ATOX1 protein(Q9TT99)(1-68 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-68 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 14.3 kDa |
AASequence : | MPKHEFSVDMTCEGCSNAVSRVLNKLGGVEFDIDLPNKKVCINSEHSVDILLETLEKTGKAVSYLGPK |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | ATOX1 ATX1 antioxidant protein 1 homolog (yeast) [ Canis lupus familiaris ] |
Official Symbol | ATOX1 |
Synonyms | ATOX1; ATX1 antioxidant protein 1 homolog (yeast); copper transport protein ATOX1; copper chaperone; metal transport protein ATX1; |
Gene ID | 403713 |
mRNA Refseq | NM_001003119 |
Protein Refseq | NP_001003119 |
◆ Recombinant Proteins | ||
ATOX1-26191TH | Recombinant Human ATOX1, His-tagged | +Inquiry |
ATOX1-506R | Recombinant Rat ATOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATOX1-2741H | Recombinant Human Antioxidant Protein 1 Homolog (Yeast) | +Inquiry |
ATOX1-6909H | Recombinant Human ATX1 Antioxidant Protein 1 Homolog (yeast), His-tagged | +Inquiry |
ATOX1-9973M | Recombinant Mouse ATOX1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATOX1-8616HCL | Recombinant Human ATOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATOX1 Products
Required fields are marked with *
My Review for All ATOX1 Products
Required fields are marked with *