Recombinant Dog ATOX1 protein, His-tagged

• Cat.No.: ATOX1-4564D
• Product Overview: Recombinant Dog ATOX1 protein(Q9TT99)(1-68 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Dog
• Source: E.coli
• Tag: His
• Protein Length: 1-68 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 14.3 kDa
• AASequence: MPKHEFSVDMTCEGCSNAVSRVLNKLGGVEFDIDLPNKKVCINSEHSVDILLETLEKTGKAVSYLGPK
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: ATOX1 ATX1 antioxidant protein 1 homolog (yeast) [ Canis lupus familiaris ]
• Official Symbol: ATOX1
• Synonyms: ATOX1; ATX1 antioxidant protein 1 homolog (yeast); copper transport protein ATOX1; copper chaperone; metal transport protein ATX1
• Gene ID: 403713
• mRNA Refseq: NM_001003119
• Protein Refseq: NP_001003119