Recombinant Dog BCL2 protein, His-tagged
| Cat.No. : | BCL2-5732D |
| Product Overview : | Recombinant Dog BCL2 protein(Q6R755)(1-236aa), fused with N-terminal His tag, was expressed in vitro E.coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-236aa |
| Tag : | N-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.0 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPAVHRDMAARTSPLRPIVATTGPTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK |
| Gene Name | BCL2 B-cell CLL/lymphoma 2 [ Canis lupus familiaris ] |
| Official Symbol | BCL2 |
| Synonyms | BCL2; B-cell CLL/lymphoma 2; apoptosis regulator Bcl-2; BCL-2; |
| Gene ID | 403416 |
| mRNA Refseq | NM_001002949 |
| Protein Refseq | NP_001002949 |
| ◆ Recombinant Proteins | ||
| RFL20057MF | Recombinant Full Length Mouse Apoptosis Regulator Bcl-2(Bcl2) Protein, His-Tagged | +Inquiry |
| BCL2-2337M | Recombinant Mouse BCL2 Protein | +Inquiry |
| RFL23045HF | Recombinant Full Length Human Apoptosis Regulator Bcl-2(Bcl2) Protein, His-Tagged | +Inquiry |
| BCL2-266H | Recombinant Human BCL2 protein, His-tagged | +Inquiry |
| BCL2-438H | Recombinant Human BCL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCL2-327HKCL | Human BCL2 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2 Products
Required fields are marked with *
My Review for All BCL2 Products
Required fields are marked with *



