Recombinant Dog CALCA protein, His-SUMO-tagged
Cat.No. : | CALCA-2620D |
Product Overview : | Recombinant Dog CALCA protein(P41547)(85-116aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 85-116aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.4 kDa |
AA Sequence : | CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CALCA calcitonin-related polypeptide alpha [ Canis lupus familiaris ] |
Official Symbol | CALCA |
Synonyms | CALCA; calcitonin-related polypeptide alpha; calcitonin; calcitonin/calcitonin-related polypeptide, alpha; |
Gene ID | 403946 |
mRNA Refseq | NM_001003266 |
Protein Refseq | NP_001003266 |
◆ Recombinant Proteins | ||
CALCA-6732H | Recombinant Human CALCA protein, GST-tagged | +Inquiry |
CALCA-708H | Recombinant Human CALCA Protein, His/GST-tagged | +Inquiry |
CALCA-8634H | Recombinant Human CALCA, GST tagged | +Inquiry |
CALCA-1087R | Recombinant Rat CALCA Protein | +Inquiry |
CALCA-3807C | Recombinant Chicken CALCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALCA-7895HCL | Recombinant Human CALCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALCA Products
Required fields are marked with *
My Review for All CALCA Products
Required fields are marked with *