Recombinant Dog CALCA protein, His-SUMO-tagged
| Cat.No. : | CALCA-2620D |
| Product Overview : | Recombinant Dog CALCA protein(P41547)(85-116aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 85-116aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 19.4 kDa |
| AA Sequence : | CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CALCA calcitonin-related polypeptide alpha [ Canis lupus familiaris ] |
| Official Symbol | CALCA |
| Synonyms | CALCA; calcitonin-related polypeptide alpha; calcitonin; calcitonin/calcitonin-related polypeptide, alpha; |
| Gene ID | 403946 |
| mRNA Refseq | NM_001003266 |
| Protein Refseq | NP_001003266 |
| ◆ Recombinant Proteins | ||
| CALCA-0063H | Recombinant Human CALCA Protein | +Inquiry |
| CALCA-613H | Recombinant Human CALCA Protein, His&GST-tagged | +Inquiry |
| CALCA-10658H | Recombinant Human CALCA, GST-tagged | +Inquiry |
| CALCA-519H | Recombinant Human CALCA Protein, His-tagged | +Inquiry |
| CALCA-0064H | Recombinant Human CALCA Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CALCA-7895HCL | Recombinant Human CALCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALCA Products
Required fields are marked with *
My Review for All CALCA Products
Required fields are marked with *
