Recombinant Dog CANF2 Protein, His-SUMO-tagged

• Cat.No.: CANF2-1281D
• Product Overview: Recombinant Dog CANF2 Protein (19-180aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: Dog
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 19-180 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 34.4 kDa
• AA Sequence: QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLT
  AFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCED
  IGLHKDQIVVLSDDDRCQGSRD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: CANF2 minor allergen Can f 2 [ Canis lupus familiaris (dog) ]
• Official Symbol: CANF2
• Synonyms: Can f 2; CANF2; Allergen Dog 2; Minor allergen Can f 2
• Gene ID: 403829
• mRNA Refseq: NM_001003189.2
• Protein Refseq: NP_001003189.1
• UniProt ID: O18874