Recombinant Dog CD8A protein, His-tagged

• Cat.No.: CD8A-8544D
• Product Overview: Recombinant Dog CD8A protein(P33706)(22-186aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Dog
• Source: E.coli
• Tag: His
• Protein Length: 22-186a.a.
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 24.1 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SGPSRFRMTPPKVVGQLHAQVELQCQVLLSTAAPGCSWLYQRNEPAARPVFLMYISQSRAKPAEGLDTKHISGQKKTDSTYSLTLSRFRKEDEGYYFCSVLSNSILYFSPFVPVFLPVKPPTTPAPRPPTRAPTNASKPVSPRGETCRPAAGSAVKTSGLDFACE

Gene Information

• Gene Name: CD8A CD8a molecule [ Canis lupus familiaris ]
• Official Symbol: CD8A
• Synonyms: CD8A; CD8a molecule; T-cell surface glycoprotein CD8 alpha chain; CD8 antigen, alpha polypeptide (p32)
• Gene ID: 403157
• mRNA Refseq: NM_001002935
• Protein Refseq: NP_001002935