Recombinant Dog CD8A protein, His-tagged
Cat.No. : | CD8A-8544D |
Product Overview : | Recombinant Dog CD8A protein(P33706)(22-186aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-186a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SGPSRFRMTPPKVVGQLHAQVELQCQVLLSTAAPGCSWLYQRNEPAARPVFLMYISQSRAKPAEGLDTKHISGQKKTDSTYSLTLSRFRKEDEGYYFCSVLSNSILYFSPFVPVFLPVKPPTTPAPRPPTRAPTNASKPVSPRGETCRPAAGSAVKTSGLDFACE |
Gene Name | CD8A CD8a molecule [ Canis lupus familiaris ] |
Official Symbol | CD8A |
Synonyms | CD8A; CD8a molecule; T-cell surface glycoprotein CD8 alpha chain; CD8 antigen, alpha polypeptide (p32); |
Gene ID | 403157 |
mRNA Refseq | NM_001002935 |
Protein Refseq | NP_001002935 |
◆ Recombinant Proteins | ||
CD8A-5302H | Recombinant Human CD8A Protein (Met1-Asp182), C-His tagged | +Inquiry |
CD8A-922R | Recombinant Rat CD8A Protein, His (Fc)-Avi-tagged | +Inquiry |
CD8A-3274H | Recombinant Human CD8A protein(Met1-Asp182), His-tagged, Biotinylated | +Inquiry |
CD8A-3196H | Active Recombinant Human CD8A protein, His-tagged | +Inquiry |
CD8A-6744H | Recombinant Human CD8A protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD8A-1872FCL | Recombinant Ferret CD8A cell lysate | +Inquiry |
CD8A-2493HCL | Recombinant Human CD8A cell lysate | +Inquiry |
CD8A-827RCL | Recombinant Rat CD8A cell lysate | +Inquiry |
CD8A-2514MCL | Recombinant Mouse CD8A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD8A Products
Required fields are marked with *
My Review for All CD8A Products
Required fields are marked with *
0
Inquiry Basket