Recombinant Dog CMA1 Protein (22-249 aa), His-SUMO-tagged
Cat.No. : | CMA1-412D |
Product Overview : | Recombinant Dog CMA1 Protein (22-249 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 22-249 aa |
Description : | Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 41.5 kDa |
AA Sequence : | IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | CMA1 chymase 1, mast cell [ Canis lupus familiaris ] |
Official Symbol | CMA1 |
Synonyms | CMA1; chymase; alpha-chymase; |
Gene ID | 490628 |
mRNA Refseq | NM_001013424 |
Protein Refseq | NP_001013442 |
UniProt ID | P21842 |
◆ Recombinant Proteins | ||
CMA1-161C | Recombinant Cynomolgus Monkey CMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CMA1-1477R | Recombinant Rat CMA1 Protein | +Inquiry |
CMA1-1530H | Recombinant Human CMA1 Protein, GST-tagged | +Inquiry |
Cma1-211M | Recombinant Mouse Cma1 Protein, His-tagged | +Inquiry |
CMA1-1748H | Recombinant Human CMA1 Protein (Ile22-Asn247), His tagged | +Inquiry |
◆ Native Proteins | ||
CMA1-35H | Active Native Human CMA1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMA1-493HCL | Recombinant Human CMA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMA1 Products
Required fields are marked with *
My Review for All CMA1 Products
Required fields are marked with *
0
Inquiry Basket