Recombinant Dog CMA1 Protein (22-249 aa), His-SUMO-tagged

Cat.No. : CMA1-412D
Product Overview : Recombinant Dog CMA1 Protein (22-249 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : E.coli
Tag : His&SUMO
Protein Length : 22-249 aa
Description : Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 41.5 kDa
AA Sequence : IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name CMA1 chymase 1, mast cell [ Canis lupus familiaris ]
Official Symbol CMA1
Synonyms CMA1; chymase; alpha-chymase;
Gene ID 490628
mRNA Refseq NM_001013424
Protein Refseq NP_001013442
UniProt ID P21842

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CMA1 Products

Required fields are marked with *

My Review for All CMA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon