Recombinant Dog CMA1 Protein (22-249 aa), His-tagged

Cat.No. : CMA1-1364D
Product Overview : Recombinant Dog CMA1 Protein (22-249 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : Yeast
Tag : His
Protein Length : 22-249 aa
Description : Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 27.5 kDa
AA Sequence : IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name CMA1 chymase 1, mast cell [ Homo sapiens ]
Official Symbol CMA1
Synonyms CMA1; chymase; CYH; MCT1; MGC119890; MGC119891;
Gene ID 1215
mRNA Refseq NM_001836
Protein Refseq NP_001827
MIM 118938
UniProt ID P21842

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CMA1 Products

Required fields are marked with *

My Review for All CMA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon