Recombinant Dog CSF3 protein, His-SUMO-tagged
Cat.No. : | CSF3-2742D |
Product Overview : | Recombinant Dog CSF3 protein(P35834)(1-175aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-175aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.9 kDa |
AA Sequence : | MAPLGPTGPLPQSFLLKCLEQMRKVQADGTALQETLCATHQLCHPEELVLLGHALGIPQPPLSSCSSQALQLMGCLRQLHSGLFLYQGLLQALAGISPELAPTLDTLQLDTTDFAINIWQQMEDLGMAPAVPPTQGTMPAFTSAFQRRAGGVLVASNLQSFLELAYRALRHFAKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CSF3 colony stimulating factor 3 (granulocyte) [ Canis lupus familiaris ] |
Official Symbol | CSF3 |
Synonyms | CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor; |
Gene ID | 608246 |
◆ Recombinant Proteins | ||
CSF3-2742D | Recombinant Dog CSF3 protein, His-SUMO-tagged | +Inquiry |
CSF3-30H | Active Recombinant Human CSF3 Protein (Thr31-Pro204), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CSF3-49H | Active Recombinant Human CSF3 Protein | +Inquiry |
Csf3-181M | Recombinant Mouse Csf3 protein, His/S-tagged | +Inquiry |
CSF3-3348H | Recombinant Human CSF3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF3 Products
Required fields are marked with *
My Review for All CSF3 Products
Required fields are marked with *
0
Inquiry Basket