Recombinant Dog CSF3 protein, His-SUMO-tagged
| Cat.No. : | CSF3-2742D |
| Product Overview : | Recombinant Dog CSF3 protein(P35834)(1-175aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-175aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 34.9 kDa |
| AA Sequence : | MAPLGPTGPLPQSFLLKCLEQMRKVQADGTALQETLCATHQLCHPEELVLLGHALGIPQPPLSSCSSQALQLMGCLRQLHSGLFLYQGLLQALAGISPELAPTLDTLQLDTTDFAINIWQQMEDLGMAPAVPPTQGTMPAFTSAFQRRAGGVLVASNLQSFLELAYRALRHFAKP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CSF3 colony stimulating factor 3 (granulocyte) [ Canis lupus familiaris ] |
| Official Symbol | CSF3 |
| Synonyms | CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor; |
| Gene ID | 608246 |
| ◆ Recombinant Proteins | ||
| CSF3-180H | Recombinant Human CSF3 protein, His/S-tagged | +Inquiry |
| Csf3-169M | Recombinant Mouse Csf3, Fc-tagged | +Inquiry |
| Csf3-91M | Recombinant Mouse Csf3 | +Inquiry |
| Csf3-188C | Active Recombinant Rat Csf3 Protein | +Inquiry |
| CSF3-600H | Active Recombinant Human CSF3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF3 Products
Required fields are marked with *
My Review for All CSF3 Products
Required fields are marked with *



