Recombinant Dog CTSK protein, His-SUMO-tagged
| Cat.No. : | CTSK-2760D |
| Product Overview : | Recombinant Dog CTSK protein(Q3ZKN1)(116-330aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 116-330aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.5 kDa |
| AA Sequence : | APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPISVAIDASLTSFQFYSKGVYYDENCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CTSK cathepsin K [ Canis lupus familiaris ] |
| Official Symbol | CTSK |
| Synonyms | CTSK; cathepsin K; cathepsin K (pycnodysostosis); |
| Gene ID | 608843 |
| mRNA Refseq | NM_001033996 |
| Protein Refseq | NP_001029168 |
| ◆ Recombinant Proteins | ||
| Ctsk-2763R | Recombinant Rabbit Ctsk protein, His-tagged | +Inquiry |
| CTSK-4055M | Recombinant Mouse CTSK Protein | +Inquiry |
| CTSK-330H | Recombinant Human CTSK Protein, His-tagged | +Inquiry |
| CTSK-2760D | Recombinant Dog CTSK protein, His-SUMO-tagged | +Inquiry |
| CTSK-327C | Recombinant Cattle CTSK Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSK-7192HCL | Recombinant Human CTSK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSK Products
Required fields are marked with *
My Review for All CTSK Products
Required fields are marked with *
