Recombinant Dog IL31 Protein (24-159aa)

Cat.No. : IL31-05D
Product Overview : Recombinant Canine IL31 without tag was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Availability August 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : HEK293
Protein Length : 24-159aa
Description : IL31, also known as interleukin-31, is a cytokine with an anti-parallel four-helix bundle structure in the gp130/IL-6 cytokine family. It shares several structural and functional characteristics with IL-6, Oncostatin M, LIF, and Cardiotrophin-1. This protein is mainly associated with activated T cells and is preferentially expressed by type 2 helper T cells (Th2). This protein is an inflammatory cytokine that helps trigger cell-mediated immunity against pathogens. It has also been identified as a major player in a number of chronic inflammatory diseases, including atopic dermatitis.
Form : Liquid
Molecular Mass : 15.3 kDa (136aa)
AA Sequence : SHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Notes : Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name IL31 interleukin 31 [ Canis lupus familiaris (dog) ]
Official Symbol IL31
Synonyms IL31; interleukin 31; interleukin-31
Gene ID 100302725
mRNA Refseq NM_001165914
Protein Refseq NP_001159386
UniProt ID C7G0W1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL31 Products

Required fields are marked with *

My Review for All IL31 Products

Required fields are marked with *

0
cart-icon