Species : |
Dog |
Source : |
HEK293 |
Protein Length : |
24-159aa |
Description : |
IL31, also known as interleukin-31, is a cytokine with an anti-parallel four-helix bundle structure in the gp130/IL-6 cytokine family. It shares several structural and functional characteristics with IL-6, Oncostatin M, LIF, and Cardiotrophin-1. This protein is mainly associated with activated T cells and is preferentially expressed by type 2 helper T cells (Th2). This protein is an inflammatory cytokine that helps trigger cell-mediated immunity against pathogens. It has also been identified as a major player in a number of chronic inflammatory diseases, including atopic dermatitis. |
Form : |
Liquid |
Molecular Mass : |
15.3 kDa (136aa) |
AA Sequence : |
SHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ |
Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
Purity : |
> 90% by SDS-PAGE |
Applications : |
SDS-PAGE |
Notes : |
Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : |
1 mg/mL (determined by Bradford assay) |
Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |