Recombinant Dog MAP4K1 Protein, GST tagged
| Cat.No. : | MAP4K1-04D |
| Product Overview : | Recombinant Dog MAP4K1 Protein with GST tag was expressed in Baculovirus-Insect Cells. |
| Availability | December 12, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | Insect Cells |
| Tag : | GST |
| Description : | Enables ATP binding activity and MAP kinase kinase kinase kinase activity. Involved in several processes, including JNK cascade; cellular response to phorbol 13-acetate 12-myristate; and protein phosphorylation. Located in membrane. |
| Molecular Mass : | The protein has a calculated MW of 54 kDa. |
| AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKMPRDHYDLLQRLGGGTYGEVFKARDKVTGDLVAVKMVKMEPDDDVSTLQKEILILKTCRHANIVAYHGSYLWLQKFWICMEFCGAGSLQDIYQVTGPLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILINDAGEVRLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFVKVTLTKNPKKRPCATKMLSHQLV |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.174 mg/mL |
| Storage Buffer : | Sterile PBS, 10 mM GSH, pH 7.4 |
| Gene Name | MAP4K1 mitogen-activated protein kinase kinase kinase kinase 1 [ Canis lupus familiaris ] |
| Official Symbol | MAP4K1 |
| Synonyms | MAP4K1; mitogen-activated protein kinase kinase kinase kinase 1; |
| Gene ID | 484527 |
| mRNA Refseq | XM_038657074 |
| Protein Refseq | XP_038513002 |
| UniProt ID | A0A8C0KYS1 |
| ◆ Recombinant Proteins | ||
| MAP4K1-20399H | Recombinant Human MAP4K1 Protein, His tagged | +Inquiry |
| MAP4K1-27602TH | Active Recombinant Full Length Human MAP4K1 Protein, GST tagged | +Inquiry |
| MAP4K1-03M | Recombinant Monkey MAP4K1 Protein, C-His tagged | +Inquiry |
| MAP4K1-1041H | Recombinant Human Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1, GST-tagged | +Inquiry |
| MAP4K1-79H | Recombinant Human MAP4K1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP4K1 Products
Required fields are marked with *
My Review for All MAP4K1 Products
Required fields are marked with *
