Recombinant Dog MAP4K1 Protein, GST tagged

Cat.No. : MAP4K1-04D
Product Overview : Recombinant Dog MAP4K1 Protein with GST tag was expressed in Baculovirus-Insect Cells.
Availability July 04, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : Insect Cells
Tag : GST
Description : Enables ATP binding activity and MAP kinase kinase kinase kinase activity. Involved in several processes, including JNK cascade; cellular response to phorbol 13-acetate 12-myristate; and protein phosphorylation. Located in membrane.
Molecular Mass : The protein has a calculated MW of 54 kDa.
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKMPRDHYDLLQRLGGGTYGEVFKARDKVTGDLVAVKMVKMEPDDDVSTLQKEILILKTCRHANIVAYHGSYLWLQKFWICMEFCGAGSLQDIYQVTGPLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILINDAGEVRLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFVKVTLTKNPKKRPCATKMLSHQLV
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.174 mg/mL
Storage Buffer : Sterile PBS, 10 mM GSH, pH 7.4
Gene Name MAP4K1 mitogen-activated protein kinase kinase kinase kinase 1 [ Canis lupus familiaris ]
Official Symbol MAP4K1
Synonyms MAP4K1; mitogen-activated protein kinase kinase kinase kinase 1;
Gene ID 484527
mRNA Refseq XM_038657074
Protein Refseq XP_038513002
UniProt ID A0A8C0KYS1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAP4K1 Products

Required fields are marked with *

My Review for All MAP4K1 Products

Required fields are marked with *

0
cart-icon