Recombinant Dog MAP4K1 Protein, GST tagged

• Cat.No.: MAP4K1-04D
• Product Overview: Recombinant Dog MAP4K1 Protein with GST tag was expressed in Baculovirus-Insect Cells.

Specification

• Species: Dog
• Source: Insect Cells
• Tag: GST
• Description: Enables ATP binding activity and MAP kinase kinase kinase kinase activity. Involved in several processes, including JNK cascade; cellular response to phorbol 13-acetate 12-myristate; and protein phosphorylation. Located in membrane.
• Molecular Mass: The protein has a calculated MW of 54 kDa.
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKMPRDHYDLLQRLGGGTYGEVFKARDKVTGDLVAVKMVKMEPDDDVSTLQKEILILKTCRHANIVAYHGSYLWLQKFWICMEFCGAGSLQDIYQVTGPLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILINDAGEVRLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFVKVTLTKNPKKRPCATKMLSHQLV
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.174 mg/mL
• Storage Buffer: Sterile PBS, 10 mM GSH, pH 7.4

Gene Information

• Gene Name: MAP4K1 mitogen-activated protein kinase kinase kinase kinase 1 [ Canis lupus familiaris ]
• Official Symbol: MAP4K1
• Synonyms: MAP4K1; mitogen-activated protein kinase kinase kinase kinase 1
• Gene ID: 484527
• mRNA Refseq: XM_038657074
• Protein Refseq: XP_038513002
• UniProt ID: A0A8C0KYS1