Recombinant Dog MERTK protein, GST-tagged
Cat.No. : | Mertk-001D |
Product Overview : | Recombinant Dog MERTK protein with GST tag was expressed in insect cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | Insect Cells |
Tag : | GST |
Description : | In case of filovirus infection, seems to function as a cell entry factor. |
Molecular Mass : | ~ 66.147 kDa |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKDDDDKLVIRKRIQETKFGNAFTEEDSELVVNYIAKKSFCRRAIELTLRSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGSVMEGNLKEQDGTSQKVAVKTMKLDNFSQREIEEFLSEAACMKDFNHPNVIRLLGVCIEMSSQGIPKPMVILPFMKYGDLHTYLLYSRLDTGPKHIPVQILLKFMVDIAQGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMHSCWRADPLDRPTFSVLRLQLEKFLESLPEVQDKADV |
Purity : | ≥85 % as determined by SDS-PAGE |
Storage : | Long Term Storage at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.2 mg/ml |
Storage Buffer : | PBS, pH 7.4 |
Gene Name | MERTK MER proto-oncogene, tyrosine kinase [ Canis lupus familiaris (dog) ] |
Official Symbol | MERTK |
Synonyms | MERTK; MER proto-oncogene, tyrosine kinase; tyrosine-protein kinase Mer; c-mer proto-oncogene tyrosine kinase; EC 2.7.10.1 |
Gene ID | 483060 |
UniProt ID | J9P347 |
◆ Recombinant Proteins | ||
Mertk-23M | Recombinant Mouse Mertk Protein, hIgG&His-tagged | +Inquiry |
Mertk-001D | Recombinant Dog MERTK protein, GST-tagged | +Inquiry |
MERTK-3902H | Recombinant Human MERTK Protein (Arg21-Ala494), C-His tagged | +Inquiry |
MERTK-472H | Recombinant Human MERTK, Gly & Pro tagged | +Inquiry |
MERTK-2195C | Recombinant Cynomolgus MERTK protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MERTK-001HCL | Recombinant Human MERTK cell lysate | +Inquiry |
MERTK-413MCL | Recombinant Mouse MERTK cell lysate | +Inquiry |
MERTK-2888HCL | Recombinant Human MERTK cell lysate | +Inquiry |
MERTK-484HCL | Recombinant Human MERTK cell lysate | +Inquiry |
MERTK-1816MCL | Recombinant Mouse MERTK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mertk Products
Required fields are marked with *
My Review for All Mertk Products
Required fields are marked with *