Recombinant Dog MERTK protein, GST-tagged
| Cat.No. : | Mertk-001D |
| Product Overview : | Recombinant Dog MERTK protein with GST tag was expressed in insect cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | Insect Cells |
| Tag : | GST |
| Description : | In case of filovirus infection, seems to function as a cell entry factor. |
| Molecular Mass : | ~ 66.147 kDa |
| AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKDDDDKLVIRKRIQETKFGNAFTEEDSELVVNYIAKKSFCRRAIELTLRSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGSVMEGNLKEQDGTSQKVAVKTMKLDNFSQREIEEFLSEAACMKDFNHPNVIRLLGVCIEMSSQGIPKPMVILPFMKYGDLHTYLLYSRLDTGPKHIPVQILLKFMVDIAQGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMHSCWRADPLDRPTFSVLRLQLEKFLESLPEVQDKADV |
| Purity : | ≥85 % as determined by SDS-PAGE |
| Storage : | Long Term Storage at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.2 mg/ml |
| Storage Buffer : | PBS, pH 7.4 |
| Gene Name | MERTK MER proto-oncogene, tyrosine kinase [ Canis lupus familiaris (dog) ] |
| Official Symbol | MERTK |
| Synonyms | MERTK; MER proto-oncogene, tyrosine kinase; tyrosine-protein kinase Mer; c-mer proto-oncogene tyrosine kinase; EC 2.7.10.1 |
| Gene ID | 483060 |
| UniProt ID | J9P347 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mertk Products
Required fields are marked with *
My Review for All Mertk Products
Required fields are marked with *



