Recombinant Dog MMP13 Protein (28-478 aa), His-SUMO-tagged
| Cat.No. : | MMP13-2045D |
| Product Overview : | Recombinant Dog MMP13 Protein (28-478 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 28-478 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 67.5 kDa |
| AA Sequence : | LPLPSDGDDDLSEEDFQLAERYLKSYYYPLNPAGILKKSAAGSVADRLREMQSFFGLEVTGKLDDNTLDIMKKPRCGVPDVGEYNVFPRTLKWSKTNLTYRIVNYTPDLTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGTADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPRHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSRDLIFIFRGRKYWALNGYDILEGYPQKISELGFPKEVKKISAAVHFEDTGKTLFFSGNQVWSYDDTNQIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYNIWSKRIVRVMPANSLLWC |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | MMP13 matrix metallopeptidase 13 (collagenase 3) [ Canis lupus familiaris ] |
| Official Symbol | MMP13 |
| Synonyms | MMP13; collagenase 3; matrix metalloproteinase-13; |
| Gene ID | 403763 |
| UniProt ID | A0A0C6E3R7 |
| ◆ Recombinant Proteins | ||
| MMP13-239H | Recombinant Active Human MMP13 Protein, His-tagged(C-ter) | +Inquiry |
| MMP13-1018H | Recombinant Human MMP13 | +Inquiry |
| MMP13-443H | Recombinant Human matrix metallopeptidase 13 (collagenase 3), His-tagged | +Inquiry |
| MMP13-7853H | Recombinant Human MMP13 protein, His-tagged | +Inquiry |
| MMP13-038H | Recombinant Human matrix metallopeptidase 13 (collagenase 3) Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP13-4280HCL | Recombinant Human MMP13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP13 Products
Required fields are marked with *
My Review for All MMP13 Products
Required fields are marked with *
