Recombinant Dog MMP13 Protein (28-478 aa), His-SUMO-tagged
Cat.No. : | MMP13-2045D |
Product Overview : | Recombinant Dog MMP13 Protein (28-478 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 28-478 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 67.5 kDa |
AA Sequence : | LPLPSDGDDDLSEEDFQLAERYLKSYYYPLNPAGILKKSAAGSVADRLREMQSFFGLEVTGKLDDNTLDIMKKPRCGVPDVGEYNVFPRTLKWSKTNLTYRIVNYTPDLTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGTADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPRHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSRDLIFIFRGRKYWALNGYDILEGYPQKISELGFPKEVKKISAAVHFEDTGKTLFFSGNQVWSYDDTNQIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYNIWSKRIVRVMPANSLLWC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | MMP13 matrix metallopeptidase 13 (collagenase 3) [ Canis lupus familiaris ] |
Official Symbol | MMP13 |
Synonyms | MMP13; collagenase 3; matrix metalloproteinase-13; |
Gene ID | 403763 |
UniProt ID | A0A0C6E3R7 |
◆ Recombinant Proteins | ||
Mmp13-731M | Recombinant Mouse Mmp13 protein, His-tagged | +Inquiry |
MMP13-2045D | Recombinant Dog MMP13 Protein (28-478 aa), His-SUMO-tagged | +Inquiry |
MMP13-219H | Recombinant Human matrix metallopeptidase 13 Protein, His&Flag tagged | +Inquiry |
MMP13-42H | Recombinant Human MMP-13 | +Inquiry |
MMP13-4575H | Recombinant Human MMP13 Protein (Leu20-Cys471), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP13-4280HCL | Recombinant Human MMP13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP13 Products
Required fields are marked with *
My Review for All MMP13 Products
Required fields are marked with *