Recombinant Dog NPC2 Protein (22-149 aa), His-tagged

Cat.No. : NPC2-1665D
Product Overview : Recombinant Dog NPC2 Protein (22-149 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : Yeast
Tag : His
Protein Length : 22-149 aa
Description : Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the endosomal/lysosomal compartment. Both NPC1 and NPC2 function as the cellular 'tag team duo' (TTD) to catalyze the mobilization of cholesterol within the multivesicular environment of the late endosome (LE) to effect egress through the limiting bilayer of the LE. NPC2 binds unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes and transfers it to the cholesterol-binding pocket of the N-terminal domain of NPC1. Cholesterol binds to NPC1 with the hydroxyl group buried in the binding pocket and is exported from the limiting mbrane of late endosomes/ lysosomes to the ER and plasma mbrane by an unknown mechanism. The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 16.0 kDa
AA Sequence : VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name NPC2 Niemann-Pick disease, type C2 [ Canis lupus familiaris ]
Official Symbol NPC2
Synonyms NPC2; niemann Pick type C2 protein homolog; CE1;
Gene ID 403920
mRNA Refseq NM_001003242
Protein Refseq NP_001003242
UniProt ID Q28895

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPC2 Products

Required fields are marked with *

My Review for All NPC2 Products

Required fields are marked with *

0
cart-icon