Recombinant Dog NPC2 Protein (22-149 aa), His-tagged
Cat.No. : | NPC2-1665D |
Product Overview : | Recombinant Dog NPC2 Protein (22-149 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | Yeast |
Tag : | His |
Protein Length : | 22-149 aa |
Description : | Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the endosomal/lysosomal compartment. Both NPC1 and NPC2 function as the cellular 'tag team duo' (TTD) to catalyze the mobilization of cholesterol within the multivesicular environment of the late endosome (LE) to effect egress through the limiting bilayer of the LE. NPC2 binds unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes and transfers it to the cholesterol-binding pocket of the N-terminal domain of NPC1. Cholesterol binds to NPC1 with the hydroxyl group buried in the binding pocket and is exported from the limiting mbrane of late endosomes/ lysosomes to the ER and plasma mbrane by an unknown mechanism. The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.0 kDa |
AA Sequence : | VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | NPC2 Niemann-Pick disease, type C2 [ Canis lupus familiaris ] |
Official Symbol | NPC2 |
Synonyms | NPC2; niemann Pick type C2 protein homolog; CE1; |
Gene ID | 403920 |
mRNA Refseq | NM_001003242 |
Protein Refseq | NP_001003242 |
UniProt ID | Q28895 |
◆ Recombinant Proteins | ||
NPC2-3913H | Recombinant Human NPC2 Protein (Glu20-Leu151), C-His tagged | +Inquiry |
NPC2-2897R | Recombinant Rhesus Macaque NPC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPC2-878M | Recombinant Mouse NPC2 Protein (Met1-Ser149), His-tagged | +Inquiry |
NPC2-349H | Recombinant Human NPC2, His-tagged | +Inquiry |
NPC2-3078R | Recombinant Rhesus monkey NPC2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPC2-001HCL | Recombinant Human NPC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPC2 Products
Required fields are marked with *
My Review for All NPC2 Products
Required fields are marked with *
0
Inquiry Basket