Recombinant Dog PRKACA protein, His-tagged
Cat.No. : | PRKACA-4494D |
Product Overview : | Recombinant Dog PRKACA protein(Q8MJ44)(2-350aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-350aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.2 kDa |
AA Sequence : | GNAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFCEF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | PRKACA protein kinase, cAMP-dependent, catalytic, alpha [ Canis lupus familiaris ] |
Official Symbol | PRKACA |
Synonyms | PRKACA; protein kinase, cAMP-dependent, catalytic, alpha; cAMP-dependent protein kinase catalytic subunit alpha; PKA C-alpha; protein kinase A alpha; |
Gene ID | 403556 |
mRNA Refseq | NM_001003032 |
Protein Refseq | NP_001003032 |
◆ Recombinant Proteins | ||
PRKACA-13352M | Recombinant Mouse PRKACA Protein | +Inquiry |
PRKACA-1658C | Recombinant Canine PRKACA protein, His-tagged | +Inquiry |
PRKACA-3371H | Recombinant Human PRKACA protein, His-tagged | +Inquiry |
PRKACA-3908H | Recombinant Human PRKACA Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKACA-010H | Recombinant Human PRKACA protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKACA-1415HCL | Recombinant Human PRKACA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKACA Products
Required fields are marked with *
My Review for All PRKACA Products
Required fields are marked with *
0
Inquiry Basket