Recombinant Dog SOD1 protein, His-tagged

• Cat.No.: SOD1-4563D
• Product Overview: Recombinant Dog SOD1 protein(Q8WNN6)(1-153 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Dog
• Source: E.coli
• Tag: His
• Protein Length: 1-153 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 22.8 kDa
• AASequence: MEMKAVCVLKGQGPVEGTIHFVQKGSGPVVVSGTITGLTEGEHGFHVHQFEDSTQGCTSAGPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGVAIVSIEDSLIALSGDYSIIGRTMVVHEKRDDLGKGDNEESTQTGNAGSRLACGVIGIAQ
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: SOD1 superoxide dismutase 1, soluble [ Canis lupus familiaris ]
• Official Symbol: SOD1
• Synonyms: SOD1; superoxide dismutase 1, soluble; superoxide dismutase [Cu-Zn]; Cu/Zn superoxide dismutase; superoxide dismutase 1, soluble (amyotrophic lateral sclerosis 1 (adult))
• Gene ID: 403559
• mRNA Refseq: NM_001003035
• Protein Refseq: NP_001003035