Recombinant Dog SOD1 protein, His-tagged

Cat.No. : SOD1-4563D
Product Overview : Recombinant Dog SOD1 protein(Q8WNN6)(1-153 aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : E.coli
Tag : His
Protein Length : 1-153 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 22.8 kDa
AASequence : MEMKAVCVLKGQGPVEGTIHFVQKGSGPVVVSGTITGLTEGEHGFHVHQFEDSTQGCTSAGPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGVAIVSIEDSLIALSGDYSIIGRTMVVHEKRDDLGKGDNEESTQTGNAGSRLACGVIGIAQ
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name SOD1 superoxide dismutase 1, soluble [ Canis lupus familiaris ]
Official Symbol SOD1
Synonyms SOD1; superoxide dismutase 1, soluble; superoxide dismutase [Cu-Zn]; Cu/Zn superoxide dismutase; superoxide dismutase 1, soluble (amyotrophic lateral sclerosis 1 (adult));
Gene ID 403559
mRNA Refseq NM_001003035
Protein Refseq NP_001003035

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOD1 Products

Required fields are marked with *

My Review for All SOD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon