Recombinant Dog SOD1 protein, His-tagged
| Cat.No. : | SOD1-4563D |
| Product Overview : | Recombinant Dog SOD1 protein(Q8WNN6)(1-153 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-153 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 22.8 kDa |
| AASequence : | MEMKAVCVLKGQGPVEGTIHFVQKGSGPVVVSGTITGLTEGEHGFHVHQFEDSTQGCTSAGPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGVAIVSIEDSLIALSGDYSIIGRTMVVHEKRDDLGKGDNEESTQTGNAGSRLACGVIGIAQ |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | SOD1 superoxide dismutase 1, soluble [ Canis lupus familiaris ] |
| Official Symbol | SOD1 |
| Synonyms | SOD1; superoxide dismutase 1, soluble; superoxide dismutase [Cu-Zn]; Cu/Zn superoxide dismutase; superoxide dismutase 1, soluble (amyotrophic lateral sclerosis 1 (adult)); |
| Gene ID | 403559 |
| mRNA Refseq | NM_001003035 |
| Protein Refseq | NP_001003035 |
| ◆ Recombinant Proteins | ||
| SOD1-05H | Active Recombinant Human Superoxide Dismutase 1 / SOD1 protein, Tag Free | +Inquiry |
| SOD1-328H | Recombinant Human SOD1 protein, His/MBP-tagged | +Inquiry |
| Sod1-2023M | Recombinant Mouse Sod1 protein, His-tagged | +Inquiry |
| SOD1-1037H | Recombinant Human SOD1 Protein | +Inquiry |
| SOD1-2069H | Recombinant Human SOD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| SOD1-101B | Active Native Bovine SOD | +Inquiry |
| SOD1-102B | Active Native Bovine SOD, modified | +Inquiry |
| CED026 | Active Bovine Superoxide Dismutase (SOD), High Purity >95% | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOD1-1576HCL | Recombinant Human SOD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOD1 Products
Required fields are marked with *
My Review for All SOD1 Products
Required fields are marked with *



