Recombinant Drosophila Melanogaster UBC6 Protein (1-151 aa), His-tagged

• Cat.No.: UBC6-1588D
• Product Overview: Recombinant Drosophila Melanogaster (Fruit fly) UBC6 Protein (1-151 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Drosophila
• Source: Yeast
• Tag: His
• Protein Length: 1-151 aa
• Description: Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 19.2 kDa
• AA Sequence: MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Ubc6 Ubiquitin conjugating enzyme 6 [ Drosophila melanogaster (fruit fly) ]
• Official Symbol: UBC6
• Synonyms: BcDNA:RE56673; CG2013; Dhr6; Dmel\CG2013; dRad6; dRAD6; Rad6; RAD6; Rad6a; UBC6; Ubcd6; UbcD6
• Gene ID: 40610
• mRNA Refseq: NM_079506
• Protein Refseq: NP_524230
• UniProt ID: P25153