Recombinant E. coli Beta-lactamase TEM Protein, His-SUMO-tagged
| Cat.No. : | bla-1145E |
| Product Overview : | Recombinant E. coli (strain K12) Beta-lactamase TEM Protein (P62593, 24-268 aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 24-268 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 44.9 kDa |
| AA Sequence : | HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRI HYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKS GAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | TEM-1 hypothetical protein [ Escherichia coli ] |
| Official Symbol | bla |
| Synonyms | IRT-4 Penicillinase; TEM-1; bla; TEM; Beta-lactamase; Beta-lactamase TEM |
| Gene ID | 2716540 |
| Protein Refseq | NP_957565.1 |
| UniProt ID | P62593 |
| ◆ Native Proteins | ||
| BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All bla Products
Required fields are marked with *
My Review for All bla Products
Required fields are marked with *



