Recombinant E. coli ECs4214 Protein, His-SUMO-tagged
| Cat.No. : | ECs4214-1338E |
| Product Overview : | Recombinant E. coli ECs4214 Protein (25-190aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 25-190 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 34.1 kDa |
| AA Sequence : | AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPN PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQ VPTHDVGPYQNVPSKPVVILSAKVLP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | ECs4214 peptidyl-prolyl cis-trans isomerase A [ Escherichia coli O157:H7 str. Sakai ] |
| Official Symbol | ECs4214 |
| Synonyms | peptidyl-prolyl cis-trans isomerase A; ECs4214; ppiA; EC 5.2.1.8; PPIase A; Cyclophilin A; Rotamase A |
| Gene ID | 915930 |
| Protein Refseq | NP_312241.1 |
| UniProt ID | P0AFL5 |
| ◆ Recombinant Proteins | ||
| ECs4214-1338E | Recombinant E. coli ECs4214 Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ECs4214 Products
Required fields are marked with *
My Review for All ECs4214 Products
Required fields are marked with *
