Recombinant E. coli fimH Protein
Cat.No. : | fimH-16E |
Product Overview : | Recombinant E. coli fimH Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Description : | type 1 fimbriae D-mannose specific adhesin |
Form : | Liquid. In 1 x PBS, pH 7.4. |
Molecular Mass : | ~29.1 kDa |
AA Sequence : | FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ |
Endotoxin : | Removed (9.31mg). |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.3 mg/ml |
Official Full Name : | Type 1 fimbriae D-mannose specific adhesin |
Gene Name | fimH type 1 fimbriae D-mannose specific adhesin [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | fimH |
Synonyms | ECK4311; pilE |
Gene ID | 948847 |
Protein Refseq | NP_418740 |
UniProt ID | P08191 |
◆ Recombinant Proteins | ||
fimH-23E | Recombinant Escherichia coli fimH Protein, His-tagged | +Inquiry |
fimH-16E | Recombinant E. coli fimH Protein | +Inquiry |
fimH-4253E | Recombinant Escherichia coli (strain K12) fimH protein, SKIK&His-tagged | +Inquiry |
fimH-6755E | Recombinant Escherichia coli (strain K12) fimH protein, His-tagged | +Inquiry |
fimH-4215E | Recombinant Escherichia coli fimH protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All fimH Products
Required fields are marked with *
My Review for All fimH Products
Required fields are marked with *