Recombinant E. coli fimH Protein
| Cat.No. : | fimH-16E |
| Product Overview : | Recombinant E. coli fimH Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Description : | type 1 fimbriae D-mannose specific adhesin |
| Form : | Liquid. In 1 x PBS, pH 7.4. |
| Molecular Mass : | ~29.1 kDa |
| AA Sequence : | FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ |
| Endotoxin : | Removed (9.31mg). |
| Purity : | >90% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.3 mg/ml |
| Official Full Name : | Type 1 fimbriae D-mannose specific adhesin |
| Gene Name | fimH type 1 fimbriae D-mannose specific adhesin [ Escherichia coli str. K-12 substr. MG1655 ] |
| Official Symbol | fimH |
| Synonyms | ECK4311; pilE |
| Gene ID | 948847 |
| Protein Refseq | NP_418740 |
| UniProt ID | P08191 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All fimH Products
Required fields are marked with *
My Review for All fimH Products
Required fields are marked with *
