Recombinant Escherichia coli FIMH Protein (22-300 aa)
Cat.No. : | FIMH-2102E |
Product Overview : | Recombinant Escherichia coli (strain K12) FIMH Protein (22-300 aa) is produced by Yeast expression system. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | Yeast |
Tag : | Non |
Protein Length : | 22-300 aa |
Description : | Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 29.1 kDa |
AA Sequence : | FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | fimH type 1 fimbriae D-mannose specific adhesin [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | FIMH |
Synonyms | ECK4311; pilE; |
Gene ID | 948847 |
Protein Refseq | NP_418740 |
UniProt ID | P08191 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FIMH Products
Required fields are marked with *
My Review for All FIMH Products
Required fields are marked with *