Recombinant E. coli Glyoxylate/hydroxypyruvate reductase A Protein, His-SUMO-tagged
Cat.No. : | ghrA-1227E |
Product Overview : | Recombinant E. coli (strain 55989 / EAEC) Glyoxylate/hydroxypyruvate reductase A Protein (1-312aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-312 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 51.4 kDa |
AA Sequence : | MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Glyoxylate/hydroxypyruvate reductase A |
Official Symbol | Glyoxylate/hydroxypyruvate reductase A |
Synonyms | Glyoxylate/hydroxypyruvate reductase A; EC 1.1.1.79; EC 1.1.1.81; 2-ketoacid reductase; ghrA |
UniProt ID | B7LFE3 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Glyoxylate/hydroxypyruvate reductase A Products
Required fields are marked with *
My Review for All Glyoxylate/hydroxypyruvate reductase A Products
Required fields are marked with *