Recombinant E. coli K99 Fimbrial Protein, His-SUMO-tagged

Cat.No. : fanC-1206E
Product Overview : Recombinant E. coli K99 Fimbrial Protein (23-181aa) was expressed in E. coli with N-terminal His-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His&SUMO
Protein Length : 23-181 a.a.
Description : Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.
FanC is the main component of the K99 fimbriae.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 32.5 kDa
AA Sequence : NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGS
MNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSN
GGYKAGVFTTSASFLVTYM
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name K99 fimbrial protein
Official Symbol K99 fimbrial protein
Synonyms K99 fimbrial protein; fanC
UniProt ID P18103

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All K99 fimbrial protein Products

Required fields are marked with *

My Review for All K99 fimbrial protein Products

Required fields are marked with *

0
cart-icon