Recombinant E. coli K99 Fimbrial Protein, His-SUMO-tagged
| Cat.No. : | fanC-1206E |
| Product Overview : | Recombinant E. coli K99 Fimbrial Protein (23-181aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 23-181 a.a. |
| Description : | Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs. FanC is the main component of the K99 fimbriae. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 32.5 kDa |
| AA Sequence : | NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGS MNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSN GGYKAGVFTTSASFLVTYM |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | K99 fimbrial protein |
| Official Symbol | K99 fimbrial protein |
| Synonyms | K99 fimbrial protein; fanC |
| UniProt ID | P18103 |
| ◆ Recombinant Proteins | ||
| fanC-1206E | Recombinant E. coli K99 Fimbrial Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All K99 fimbrial protein Products
Required fields are marked with *
My Review for All K99 fimbrial protein Products
Required fields are marked with *
Recently Viewed
