Recombinant E.coli map, His-tagged
Cat.No. : | map-91E |
Product Overview : | Recombinant E. coli Methionine Aminopeptidase/MAP is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Glu264) of E.coli MAP. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-264 a.a. |
Description : | Methionine aminopeptidase 1, METAP, also named MAP 1, MetAP 1, Peptidase M 1, is a member of the M24 family of metalloproteases. METAPs play a central role for protein maturation as they remove the initiator Met residue from newly synthesized proteins and are essential for cell growth. Three METAP genes (METAP1, METAP2 and MAP1D) have been identified in the human genome. METAP1 and METAP2 have different substrate specificity due to the differences in both size and shape of the active sites. METAP1 plays an important role in G(2)/M phase regulation of the cell cycle and may serve as a promising target for the discovery and development of new anticancer agents. Fumagillin, a natural compound, covalently modifies an active His residue of METAP2 and prevents the vascularization and metasis of tumors. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 100mM NaCl, 50% Glycerol, pH 8.0 |
AA Sequence : | MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGY PKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQ ESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVL KPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAII SHDELEHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
◆ Native Proteins | ||
MAP-02M | Native Mussel Adhesive Protein | +Inquiry |
MAP-30 | Native Mytilus edulis MAP Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All map Products
Required fields are marked with *
My Review for All map Products
Required fields are marked with *
0
Inquiry Basket