Recombinant E. coli mppA Protein, His-SUMO-tagged

Cat.No. : mppA-1285E
Product Overview : Recombinant E. coli (strain K12) mppA Protein (23-537aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His&SUMO
Protein Length : 23-537 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 73.6 kDa
AA Sequence : AEVPSGTVLAEKQELVRHIKDEPASLDPAKAVGLPEIQVIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQKGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFEQMSQEELNAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVKARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYPINNPEDVAYSRTMYIVKH
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name mppA murein tripeptide (L-ala-gamma-D-glutamyl-meso-DAP) transporter subunit [ Escherichia coli str. K-12 substr. MG1655 ]; ynaH
Official Symbol mppA
Synonyms mppA; Periplasmic murein peptide-binding protein
Gene ID 945951
Protein Refseq NP_415845.2
UniProt ID P77348

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All mppA Products

Required fields are marked with *

My Review for All mppA Products

Required fields are marked with *

0
cart-icon
0
compare icon